07 - Programming for UniProt¶
Table of Contents¶
Introduction¶
The UniProt browser interface is very powerful, but you will have noticed that even the most complex queries can be converted into a single string that describes the search being made of the UniProt databases. This string is generated for you, and placed into the search field at the top of the UniProt webpage every time you run a search.
It can be tedious and time-consuming to point-and-click your way through a large number of browser-based searches, but by using the `UniProt` webservice, the search strings you've already seen, and a Python module called `bioservices`, we can compose and run as many searches as we like using computer code, and pull the results of those searches.
This notebook presents examples of methods for using UniProt programmatically, via a webservice, and you will be controlling the searches using Python code in this notebook.
There are a number of advantages to this approach:
- It is easy to set up repeatable searches for many sequences, or collections of sequences
- It is easy to read in the search results and conduct downstream analyses that add value to your search
Where it is not practical to submit a large number of simultaneous queries via a web form (because it is tiresome to point-and-click over and over again), this can be handled programmatically instead. You have the opportunity to change custom options to help refine your query, compared to the website interface. If you need to repeat a query, it can be trivial to get the same settings every time, if you use a programmatic approach.
Python imports¶
In [1]:
# Show plots as part of the notebook
%matplotlib inline
# Standard library packages
import io
# Import Seaborn for graphics and plotting
import seaborn as sns
# Import bioservices module, to run remote UniProt queries
from bioservices import UniProt
# Import Pandas, so we can use dataframes
import pandas as pd
Running a remote UniProt query¶
There are three key steps to running a remote `UniProt` query with `bioservices`:
- Make a link to the
UniProtwebservice - Construct a query string
- Send the query to
UniProt, and catch the result in a variable
Once the search result is caught, it can be processed in any way you like, written to a file, or ignored.
Connecting to UniProt¶
To open a connection to UniProt, you make an instance of the UniProt() class from bioservices. This can be persistent so that, once it is created, you can interact with it over and over again.
To make a persistent instance, you can assign `UniProt()` to a variable:
service = UniProt() # it is good practice to have a meaningful variable name
Constructing a query¶
`UniProt` allows for the construction of complex searches by combining *fields*. A full discussion is beyond the scope of this lesson, but you will have seen in [notebook 06](06-uniprot_browser.ipynb) that the searches you constructed by pointing and clicking on the `UniProt` website were converted into text in the search field at the top.
To describe the format briefly: there are a set of defined keys - keywords that indicate the specific type of data you want to search in (such as host, annotation, or sequence length), and these are combined with a particular value you want to search for (such as mouse, or 40674) in a key:value pair, separated by a colon, such as host:mouse or ec:3.2.1.23.
UniProtquery fields: http://www.uniprot.org/help/query-fields
If you provide a string, instead of a key:value pair, UniProt will search in all fields for your search term.
Programmatically, we construct the query as a string, e.g.
query = "Q9AJE3" # this query means we want to look in all fields for Q9AJE3
Perform the query¶
To send the query to UniProt, you will use the .search() method of your active instance of the UniProt() class.
If you have assigned this instance to the variable `service` (as above), then you can run the `query` string as a remote search with the line:
result = service.search(query) # Run a query and catch the output in result
In the line above, the output of the search (i.e. your results) are stored in a variable called result. It is good practice to make variable names short and descriptive - this makes your code easier to read.
EXAMPLE: Putting it together¶
The code in the cell below uses the example code above to create an instance of the UniProt() class, and use it to submit a pre-stored query to the UniProt service, then catch the result in a variable called result. The print() statement then shows us what the result looks like, as returned by the service.
In [2]:
# Make a link to the UniProt webservice
service = UniProt()
# Build a query string
query = "Q9AJE3"
# Send the query to UniProt, and catch the search result in a variable
result = service.search(query)
# Inspect the result
print(result)
Creating directory /Users/lpritc/Library/Caches/bioservices Entry Entry name Status Protein names Gene names Organism Length Q9AJE3 CYC2_KITGR reviewed Terpentetriene synthase (EC 4.2.3.36) cyc2 Kitasatospora griseola (Streptomyces griseolosporeus) 311
The UniProt() instance defined in the cell above is persistent, so you can reuse it to make another query, as in the cell below:
In [3]:
# Make a new query string, and run a remote search at UniProt
new_query = "Q01844"
new_result = service.search(new_query)
# Inspect the result
print(new_result)
Entry Entry name Status Protein names Gene names Organism Length Q01844 EWS_HUMAN reviewed RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) EWSR1 EWS Homo sapiens (Human) 656 Q9NZ81 PRR13_HUMAN reviewed Proline-rich protein 13 (Taxane-resistance protein) PRR13 TXR1 BM-041 Homo sapiens (Human) 148 O95486 SC24A_HUMAN reviewed Protein transport protein Sec24A (SEC24-related protein A) SEC24A Homo sapiens (Human) 1093 O94855 SC24D_HUMAN reviewed Protein transport protein Sec24D (SEC24-related protein D) SEC24D KIAA0755 Homo sapiens (Human) 1032 Q9UBV8 PEF1_HUMAN reviewed Peflin (PEF protein with a long N-terminal hydrophobic domain) (Penta-EF hand domain-containing protein 1) PEF1 ABP32 UNQ1845/PRO3573 Homo sapiens (Human) 284 Q9NS23 RASF1_HUMAN reviewed Ras association domain-containing protein 1 RASSF1 RDA32 Homo sapiens (Human) 344 O15162 PLS1_HUMAN reviewed Phospholipid scramblase 1 (PL scramblase 1) (Ca(2+)-dependent phospholipid scramblase 1) (Erythrocyte phospholipid scramblase) (MmTRA1b) PLSCR1 Homo sapiens (Human) 318 Q99873 ANM1_HUMAN reviewed Protein arginine N-methyltransferase 1 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT1) (Interferon receptor 1-bound protein 4) PRMT1 HMT2 HRMT1L2 IR1B4 Homo sapiens (Human) 361 P35637 FUS_HUMAN reviewed RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) FUS TLS Homo sapiens (Human) 526 Q92993 KAT5_HUMAN reviewed Histone acetyltransferase KAT5 (EC 2.3.1.48) (60 kDa Tat-interactive protein) (Tip60) (Histone acetyltransferase HTATIP) (HIV-1 Tat interactive protein) (Lysine acetyltransferase 5) (cPLA(2)-interacting protein) KAT5 HTATIP TIP60 Homo sapiens (Human) 513 Q09472 EP300_HUMAN reviewed Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) EP300 P300 Homo sapiens (Human) 2414 Q9BWW4 SSBP3_HUMAN reviewed Single-stranded DNA-binding protein 3 (Sequence-specific single-stranded-DNA-binding protein) SSBP3 SSDP SSDP1 Homo sapiens (Human) 388 Q13077 TRAF1_HUMAN reviewed TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6) TRAF1 EBI6 Homo sapiens (Human) 416 Q12933 TRAF2_HUMAN reviewed TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3) TRAF2 TRAP3 Homo sapiens (Human) 501 Q92734 TFG_HUMAN reviewed Protein TFG (TRK-fused gene protein) TFG Homo sapiens (Human) 400 Q8N5M1 ATPF2_HUMAN reviewed ATP synthase mitochondrial F1 complex assembly factor 2 (ATP12 homolog) ATPAF2 ATP12 LP3663 Homo sapiens (Human) 289 P49910 ZN165_HUMAN reviewed Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7) ZNF165 ZPF165 ZSCAN7 Homo sapiens (Human) 485 Q8NDC0 MISSL_HUMAN reviewed MAPK-interacting and spindle-stabilizing protein-like (Mitogen-activated protein kinase 1-interacting protein 1-like) MAPK1IP1L C14orf32 Homo sapiens (Human) 245 B0QYK0 B0QYK0_HUMAN unreviewed RNA-binding protein EWS EWSR1 Homo sapiens (Human) 618 C9JGE3 C9JGE3_HUMAN unreviewed EWS RNA-binding protein variant 6 (RNA-binding protein EWS) EWSR1 Homo sapiens (Human) 620 A0A0D9SFL3 A0A0D9SFL3_HUMAN unreviewed RNA-binding protein EWS EWSR1 Homo sapiens (Human) 584 H7BY36 H7BY36_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 308 B0QYJ4 B0QYJ4_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 166 F8WC90 F8WC90_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 292 B0QYJ7 B0QYJ7_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 233 B0QYJ6 B0QYJ6_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 180 B0QYJ3 B0QYJ3_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 156 B0QYJ5 B0QYJ5_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 77
Advanced queries¶
The examples above built queries that were simple strings. They did not exploit the `key:value` search structure, or combine search terms. In this section, you will explore some queries that use the `UniProt` query fields, and combine them into powerful, filtering searches.
key:value queries¶
As noted above (and at http://www.uniprot.org/help/query-fields) particular values of specific data can be requested by using key:value pairs to restrict searches to named fields in the UniProt database.
As a first example, you will note that the result returned for the query "Q01844" has multiple entries. Only one of these is the sequence with accession value equal to "Q01844", but the other entries make reference to this sequence somewhere in their database record. If we want to restrict our result only to the particular entry "Q01844", we can specify the field we want to search as accession, and build the following query:
query = "accession:Q01844" # specify a search on the accession field
Note that we can use the same variable name query as earlier (this overwrites the previous value in query). The code below runs the search and shows the output:
In [4]:
# Make a new query string, and run a remote search at UniProt
query = "accession:Q01844"
result = service.search(query)
# Inspect the result
print(result)
Entry Entry name Status Protein names Gene names Organism Length Q01844 EWS_HUMAN reviewed RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) EWSR1 EWS Homo sapiens (Human) 656
By using this and other `key:value` constructions, we can refine our searches to give us only the entries we're interested in
Exercise 01 (10min)¶
Using key:value searches, can you find and download sets of entries for proteins that satisfy the following requirements? (HINT: this link to the UniProt query fields may be helpful, here):
- Have publications authored by someone with the surname Broadhurst
- Have protein length between 9000aa and 9010aa
- Derive from the taipan snake
- Have been found in the wing
In [5]:
# SOLUTION - EXERCISE 01
queries = ["author:broadhurst", "length:[9000 TO 9010]", "organism:taipan", "tissue:wing"]
for query in queries:
print("\n%s" % query)
print("=" * len(query))
result = service.search(query)
print(result)
author:broadhurst ================= Entry Entry name Status Protein names Gene names Organism Length P83917 CBX1_MOUSE reviewed Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Heterochromatin protein p25) (M31) (Modifier 1 protein) Cbx1 Cbx Mus musculus (Mouse) 185 P03956 MMP1_HUMAN reviewed Interstitial collagenase (EC 3.4.24.7) (Fibroblast collagenase) (Matrix metalloproteinase-1) (MMP-1) [Cleaved into: 22 kDa interstitial collagenase; 27 kDa interstitial collagenase] MMP1 CLG Homo sapiens (Human) 469 P0AFG6 ODO2_ECOLI reviewed Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) sucB b0727 JW0716 Escherichia coli (strain K12) 405 P10515 ODP2_HUMAN reviewed Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (70 kDa mitochondrial autoantigen of primary biliary cirrhosis) (PBC) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (M2 antigen complex 70 kDa subunit) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2) DLAT DLTA Homo sapiens (Human) 647 Q32NN2 QKIA_XENLA reviewed Protein quaking-A (Xqua) qki-a Xenopus laevis (African clawed frog) 341 Q03132 ERYA2_SACER reviewed 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 (DEBS 2) (EC 2.3.1.94) (6-deoxyerythronolide B synthase II) (Erythronolide synthase) (ORF B) eryA Saccharopolyspora erythraea (Streptomyces erythraeus) 3567 P63159 HMGB1_RAT reviewed High mobility group protein B1 (Amphoterin) (Heparin-binding protein p30) (High mobility group protein 1) (HMG-1) Hmgb1 Hmg-1 Hmg1 Rattus norvegicus (Rat) 215 P0ABD8 BCCP_ECOLI reviewed Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) accB fabE b3255 JW3223 Escherichia coli (strain K12) 156 Q863B3 SND1_BOVIN reviewed Staphylococcal nuclease domain-containing protein 1 (100 kDa coactivator) (p100 co-activator) SND1 Bos taurus (Bovine) 910 Q6IRN2 QKIB_XENLA reviewed Protein quaking-B qki-b Xenopus laevis (African clawed frog) 342 Q9JZ09 Q9JZ09_NEIMB unreviewed Dihydrolipoyl dehydrogenase (EC 1.8.1.4) lpdA2 NMB1344 Neisseria meningitidis serogroup B (strain MC58) 594 P56596 PSAD_NOSS8 reviewed Photosystem I reaction center subunit II (Photosystem I 16 kDa polypeptide) (PSI-D) psaD Nostoc sp. (strain PCC 8009) 138 Q6MZA5 Q6MZA5_MYCUA unreviewed Type I modular polyketide synthase mlsA2 MUP039c Mycobacterium ulcerans (strain Agy99) 2410 Q5ZPA9 Q5ZPA9_9DELT unreviewed TubC protein tubC Archangium disciforme 2625 Q9R6W5 Q9R6W5_NOSS8 unreviewed Photosystem I accessory protein D psaD Nostoc sp. (strain PCC 8009) 139 Q9WWN8 Q9WWN8_NOSS8 unreviewed Anthranilate synthase component I (Fragment) trpE Nostoc sp. (strain PCC 8009) 237 Q9WWN9 Q9WWN9_NOSS8 unreviewed Sensory transduction histidine kinase (Fragment) Nostoc sp. (strain PCC 8009) 98 Q86UF7 Q86UF7_HUMAN unreviewed 100 kDa coactivator (Fragment) Homo sapiens (Human) 16 length:[9000 TO 9010] ===================== Entry Entry name Status Protein names Gene names Organism Length A0A1K0GG54 A0A1K0GG54_9ACTN unreviewed AceP4 BG844_00045 Couchioplanes caeruleus subsp. caeruleus 9002 A0A1E7N8F6 A0A1E7N8F6_KITAU unreviewed Beta-ketoacyl synthase (Fragment) HS99_0003795 Kitasatospora aureofaciens (Streptomyces aureofaciens) 9000 A0A0P6FSU4 A0A0P6FSU4_9CRUS unreviewed Putative Neurogenic locus notch protein (Fragment) Daphnia magna 9005 A0A0P6FYY7 A0A0P6FYY7_9CRUS unreviewed Putative Neurogenic locus notch protein (Fragment) Daphnia magna 9005 A0A1L4B809 A0A1L4B809_RALSL unreviewed Non-ribosomal peptide synthetase AC251_21720 Ralstonia solanacearum (Pseudomonas solanacearum) 9007 A0A1L3DKI2 A0A1L3DKI2_RALSL unreviewed Non-ribosomal peptide synthetase BCR16_20505 Ralstonia solanacearum FJAT-1458 9004 A0A223KIT7 A0A223KIT7_RALSL unreviewed Non-ribosomal peptide synthetase CIG66_23790 Ralstonia solanacearum (Pseudomonas solanacearum) 9007 A0A0Q9XTA6 A0A0Q9XTA6_DROMO unreviewed Uncharacterized protein Dmoj\GI14082 Dmoj_GI14082 GI14082 Drosophila mojavensis (Fruit fly) 9002 A0A0Q9WLJ1 A0A0Q9WLJ1_DROVI unreviewed Uncharacterized protein, isoform W Dvir\GJ15760 Dvir_GJ15760 GJ15760 Drosophila virilis (Fruit fly) 9000 A0A0Q9WYB5 A0A0Q9WYB5_DROVI unreviewed Uncharacterized protein, isoform U Dvir\GJ15760 Dvir_GJ15760 GJ15760 Drosophila virilis (Fruit fly) 9002 A0A0Q9WY93 A0A0Q9WY93_DROVI unreviewed Uncharacterized protein, isoform J (Uncharacterized protein, isoform L) Dvir\GJ15760 Dvir_GJ15760 GJ15760 Drosophila virilis (Fruit fly) 9003 A0A0G4GJ59 A0A0G4GJ59_VITBC unreviewed Uncharacterized protein (Fragment) Vbra_4545 Vitrella brassicaformis (strain CCMP3155) 9001 A0A182NEA8 A0A182NEA8_9DIPT unreviewed Uncharacterized protein Anopheles dirus 9010 A0A0L0D1D3 A0A0L0D1D3_THETB unreviewed Uncharacterized protein AMSG_00155 Thecamonas trahens ATCC 50062 9005 organism:taipan =============== Entry Entry name Status Protein names Gene names Organism Length P00614 PA2TA_OXYSC reviewed Basic phospholipase A2 taipoxin alpha chain (svPLA2) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 119 Q45Z47 PA22_OXYSC reviewed Phospholipase A2 OS2 (PLA2) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 146 P00615 PA2TB_OXYSC reviewed Neutral phospholipase A2 homolog taipoxin beta chain 1 (svPLA2 homolog) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 145 P00616 PA2TG_OXYSC reviewed Acidic phospholipase A2 homolog taipoxin gamma chain (svPLA2 homolog) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 152 B7S4N9 VKT_OXYSC reviewed Kunitz-type serine protease inhibitor taicotoxin (Taicatoxin, serine protease inhibitor component) (TCX) (TSPI) (Venom protease inhibitor 1) (Venom protease inhibitor 2) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 88 P0CG57 PA2TC_OXYSC reviewed Neutral phospholipase A2 homolog taipoxin beta chain 2 (svPLA2 homolog) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 118 Q4VRI5 PA21_OXYSC reviewed Phospholipase A2 OS1 (PLA2) (EC 3.1.1.4) (OS5) (Phosphatidylcholine 2-acylhydrolase) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 154 Q7LZG2 PA2T_OXYSC reviewed Phospholipase A2 taicatoxin (TCX) (svPLA2) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 27 Q58L96 FAXC_OXYSU reviewed Venom prothrombin activator oscutarin-C catalytic subunit (vPA) (EC 3.4.21.6) (Factor VII activator) (Snake venom serine protease) (SVSP) (Venom coagulation factor Xa-like protease) [Cleaved into: Oscutarin-C catalytic subunit light chain; Oscutarin-C catalytic subunit heavy chain] Oxyuranus scutellatus (Coastal taipan) 467 P83228 VNPB_OXYSC reviewed Natriuretic peptide TNP-b (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPb) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 111 Q58L91 FA5V_OXYSU reviewed Venom prothrombin activator oscutarin-C non-catalytic subunit (vPA) (Venom coagulation factor Va-like protein) [Cleaved into: Oscutarin-C non-catalytic subunit heavy chain; Oscutarin-C non-catalytic subunit light chain] Oxyuranus scutellatus (Coastal taipan) 1459 Q45Z11 3S11_OXYSC reviewed Short neurotoxin 1 (SNTX-1) (Toxin 3) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 83 P0DKT7 PA2CA_OXYSA reviewed Basic phospholipase A2 cannitoxin alpha chain (svPLA2) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase) (Fragment) Oxyuranus scutellatus canni (Papuan taipan) 20 Q4JHE3 OXLA_OXYSC reviewed L-amino-acid oxidase (LAAO) (LAO) (EC 1.4.3.2) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 517 Q58L95 FAXC_OXYMI reviewed Venom prothrombin activator omicarin-C catalytic subunit (vPA) (EC 3.4.21.6) (Venom coagulation factor Xa-like protease) [Cleaved into: Omicarin-C catalytic subunit light chain; Omicarin-C catalytic subunit heavy chain] Oxyuranus microlepidotus (Inland taipan) 467 P83225 VNPA_OXYSC reviewed Natriuretic peptide TNP-a (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPa) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 35 Q45Z42 PA2PA_OXYMI reviewed Basic phospholipase A2 paradoxin-like alpha chain (svPLA2) (EC 3.1.1.4) (PLA-4) (Phosphatidylcholine 2-acylhydrolase) Oxyuranus microlepidotus (Inland taipan) 146 P0CB06 3S12_OXYSC reviewed Short neurotoxin 2 (SNTX-2) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 62 P0CJ35 3L2L_OXYSC reviewed Taicatoxin, alpha-neurotoxin-like component (TCX, alpha-neurotoxin-like component) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 28 Q58L90 FA5V_OXYMI reviewed Venom prothrombin activator omicarin-C non-catalytic subunit (vPA) (Venom coagulation factor Va-like protein) [Cleaved into: Omicarin-C non-catalytic subunit heavy chain; Omicarin-C non-catalytic subunit light chain] Oxyuranus microlepidotus (Inland taipan) 1460 P0DKT9 PA2CC_OXYSA reviewed Neutral phospholipase A2 homolog cannitoxin beta chain 2 (svPLA2 homolog) (Fragment) Oxyuranus scutellatus canni (Papuan taipan) 40 P0DKU0 PA2CG_OXYSA reviewed Acidic phospholipase A2 homolog cannitoxin gamma chain (svPLA2 homolog) (Fragment) Oxyuranus scutellatus canni (Papuan taipan) 30 Q45Z46 PA2PB_OXYMI reviewed Neutral phospholipase A2 paradoxin-like beta chain (svPLA2) (Beta paradoxin-like) Oxyuranus microlepidotus (Inland taipan) 145 Q3I5F4 NGFV_OXYSC reviewed Venom nerve growth factor (v-NGF) (vNGF) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 243 D2YVH7 LECM_OXYSU reviewed C-type lectin mannose-binding isoform (CTL) (Venom C-type lectin mannose-binding isoform 1) Oxyuranus scutellatus (Coastal taipan) 158 P83227 VNPB_OXYMI reviewed Natriuretic peptide TNP-b (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPb) Oxyuranus microlepidotus (Inland taipan) 35 Q3HXZ0 NGFV2_OXYMI reviewed Venom nerve growth factor 2 (v-NGF-2) (vNGF-2) Oxyuranus microlepidotus (Inland taipan) 243 P0DKT8 PA2CB_OXYSA reviewed Neutral phospholipase A2 homolog cannitoxin beta chain 1 (svPLA2 homolog) (Fragment) Oxyuranus scutellatus canni (Papuan taipan) 10 Q3HXZ1 NGFV1_OXYMI reviewed Venom nerve growth factor 1 (v-NGF-1) (vNGF-1) Oxyuranus microlepidotus (Inland taipan) 243 Q3SB07 CRVP_OXYSC reviewed Cysteine-rich venom protein pseudechetoxin-like (CRVP) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 238 Q3SB06 CRVP_OXYMI reviewed Cysteine-rich venom protein pseudechetoxin-like (CRVP) (Cysteine-rich secretory protein OXY1) (CRISP-OXY1) Oxyuranus microlepidotus (Inland taipan) 238 Q3SB15 CALGL_OXYSC reviewed Calglandulin Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 156 E3P6N5 CYT_OXYMI reviewed Cystatin Oxyuranus microlepidotus (Inland taipan) 141 E3P6N6 CYT_OXYSC reviewed Cystatin Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 141 Q3SB14 CALGL_OXYMI reviewed Calglandulin Oxyuranus microlepidotus (Inland taipan) 156 A8HDK7 3L21_OXYMI reviewed Long neurotoxin 1 (LNTX-1) Oxyuranus microlepidotus (Inland taipan) 92 A8HDK8 3L22_OXYMI reviewed Long neurotoxin 2 (LNTX-2) Oxyuranus microlepidotus (Inland taipan) 92 A8HDK2 3SX3_OXYSC reviewed Short neurotoxin 3 (SNTX-3) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 79 A7X4T2 3SX6_OXYMI reviewed Toxin 3FTx-Oxy6 Oxyuranus microlepidotus (Inland taipan) 81 A7X4Q3 3L2O1_OXYMI reviewed Long neurotoxin 3FTx-Oxy1 Oxyuranus microlepidotus (Inland taipan) 92 A8HDK9 3L21_OXYSC reviewed Long neurotoxin 1 (LNTX-1) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 92 A7X4R0 3L2O2_OXYMI reviewed Long neurotoxin 3FTx-Oxy2 Oxyuranus microlepidotus (Inland taipan) 92 A7X4R5 3S13_OXYMI reviewed Short neurotoxin 3FTx-Oxy3 Oxyuranus microlepidotus (Inland taipan) 83 A7X4S7 3SX5_OXYMI reviewed Toxin 3FTx-Oxy5 Oxyuranus microlepidotus (Inland taipan) 79 Q4VRI0 3SXS_OXYSC reviewed Scutelatoxin Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 79 A7X4S0 3S14_OXYMI reviewed Short neurotoxin 3FTx-Oxy4 Oxyuranus microlepidotus (Inland taipan) 83 B5L5Q3 IVBS5_OXYSC reviewed Scutellin-5 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 79 P83231 VNPC_OXYSA reviewed Natriuretic peptide TNP-c (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPc) Oxyuranus scutellatus canni (Papuan taipan) 39 Q3SAF7 VNPE_OXYMI reviewed Natriuretic peptide OmNP-e (Fragment) Oxyuranus microlepidotus (Inland taipan) 40 B5L5M9 WAPC_OXYMI reviewed Omwaprin-c (Oxywaprin-c) Oxyuranus microlepidotus (Inland taipan) 74 P83230 VNPC_OXYMI reviewed Peptide TNP-c (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPc) Oxyuranus microlepidotus (Inland taipan) 39 Q3SAX8 VNPD_OXYSC reviewed Natriuretic peptide OsNP-d (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 45 Q6ITB5 VKT1_OXYMI reviewed Kunitz-type serine protease inhibitor microlepidin-1 Oxyuranus microlepidotus (Inland taipan) 83 Q6ITB6 VKT2_OXYSC reviewed Kunitz-type serine protease inhibitor scutellin-2 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 83 B5KL30 VKT4_OXYSC reviewed Kunitz-type serine protease inhibitor scutellin-4 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 83 P83952 WAPA_OXYMI reviewed Omwaprin-a (Oxywaprin) (Oxywaprin-a) Oxyuranus microlepidotus (Inland taipan) 50 Q3SAF8 VNPD_OXYMI reviewed Natriuretic peptide OmNP-d (Fragment) Oxyuranus microlepidotus (Inland taipan) 40 Q6ITB7 VKT1_OXYSC reviewed Kunitz-type serine protease inhibitor scutellin-1 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 83 B5KL28 VKT4_OXYMI reviewed Kunitz-type serine protease inhibitor microlepidin-4 Oxyuranus microlepidotus (Inland taipan) 83 P83224 VNPA_OXYMI reviewed Natriuretic peptide TNP-a (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPa) Oxyuranus microlepidotus (Inland taipan) 35 Q6ITB4 VKT2_OXYMI reviewed Kunitz-type serine protease inhibitor microlepidin-2 Oxyuranus microlepidotus (Inland taipan) 83 B5KL27 VKT3_OXYMI reviewed Kunitz-type serine protease inhibitor microlepidin-3 Oxyuranus microlepidotus (Inland taipan) 83 P0DJ63 VKT_OXYMI reviewed Kunitz-type serine protease inhibitor OMI (Fragment) Oxyuranus microlepidotus (Inland taipan) 17 B5KL29 VKT3_OXYSC reviewed Kunitz-type serine protease inhibitor scutellin-3 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 83 B5L5Q6 VKT5_OXYMI reviewed Kunitz-type serine protease inhibitor microlepidin-5 Oxyuranus microlepidotus (Inland taipan) 79 P83226 VNPA_OXYSA reviewed Natriuretic peptide TNP-a (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPa) Oxyuranus scutellatus canni (Papuan taipan) 35 P83229 VNPB_OXYSA reviewed Natriuretic peptide TNP-b (Taipan natriuretic peptide) (Venom natriuretic peptide OxsSNPb) Oxyuranus scutellatus canni (Papuan taipan) 35 B5G6G8 WAPA_OXYSC reviewed Scuwaprin-a Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 75 B5G6G7 WAPB_OXYMI reviewed Omwaprin-b (Oxywaprin-b) Oxyuranus microlepidotus (Inland taipan) 74 Q38R59 Q38R59_OXYSU unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 Oxyuranus scutellatus (Coastal taipan) 214 A5H9L4 A5H9L4_OXYSU unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 Oxyuranus scutellatus (Coastal taipan) 214 A5H9L3 A5H9L3_OXYSU unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 Oxyuranus scutellatus (Coastal taipan) 214 Q38R62 Q38R62_OXYMI unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 NADH4 Oxyuranus microlepidotus (Inland taipan) 214 Q38R61 Q38R61_OXYMI unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 Oxyuranus microlepidotus (Inland taipan) 214 B5KFV5 B5KFV5_OXYSU unreviewed Scutellatease-1 Oxyuranus scutellatus (Coastal taipan) 612 Q3SAZ3 Q3SAZ3_OXYSU unreviewed Proteasome-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 174 Q9PTC9 Q9PTC9_OXYSU unreviewed Phospholipase A2 inhibitor Oxyuranus scutellatus (Coastal taipan) 200 Q45Z53 Q45Z53_OXYSU unreviewed Beta taipoxin variant 1 Oxyuranus scutellatus (Coastal taipan) 145 Q3SAY6 Q3SAY6_OXYSU unreviewed KIAA0731-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 127 D2YVI1 D2YVI1_OXYSU unreviewed Venom C-type lectin mannose binding isoform 4 Oxyuranus scutellatus (Coastal taipan) 165 Q3SAY2 Q3SAY2_OXYSU unreviewed Pre-mRNA cleavage complex II protein-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 300 A0A0S2C759 A0A0S2C759_OXYSU unreviewed Cytochrome b (Fragment) cytb Oxyuranus scutellatus (Coastal taipan) 198 Q3SAZ8 Q3SAZ8_OXYSU unreviewed 40S ribosomal protein S18 (Fragment) Oxyuranus scutellatus (Coastal taipan) 95 Q45Z49 Q45Z49_OXYSU unreviewed PLA-5 Oxyuranus scutellatus (Coastal taipan) 146 Q3SAZ7 Q3SAZ7_OXYSU unreviewed 40S ribosomal protein S20 (Fragment) Oxyuranus scutellatus (Coastal taipan) 101 Q3SAY8 Q3SAY8_OXYSU unreviewed DnaJ-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 148 Q3SAY0 Q3SAY0_OXYSU unreviewed KIAA0853-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 186 Q3SAZ2 Q3SAZ2_OXYSU unreviewed PolyA binding protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 306 B5KLB4 B5KLB4_OXYSU unreviewed Vespryn isoform 2 Oxyuranus scutellatus (Coastal taipan) 190 B5KLB3 B5KLB3_OXYSU unreviewed Vespryn isoform 1 Oxyuranus scutellatus (Coastal taipan) 190 Q3SAZ1 Q3SAZ1_OXYSU unreviewed Translocon-associated protein-like protein Oxyuranus scutellatus (Coastal taipan) 149 Q4QXL7 Q4QXL7_OXYSC unreviewed NADH-ubiquinone oxidoreductase chain 4L (EC 1.6.5.3) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 91 Q4QXL4 Q4QXL4_OXYSC unreviewed EF1 (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 111 Q4VRH9 Q4VRH9_OXYSC unreviewed Protein disulfide-isomerase (EC 5.3.4.1) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 514 Q4VRH8 Q4VRH8_OXYSC unreviewed HSP70 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 635 Q1H620 Q1H620_OXYSC unreviewed Cytochrome c oxidase subunit 3 (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 221 Q4VRI3 Q4VRI3_OXYSC unreviewed OS7 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 146 Q4VRH2 Q4VRH2_OXYSC unreviewed Uncharacterized protein Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 124 Q4QXK8 Q4QXK8_OXYSC unreviewed Carboxylate synthase (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 214 Q4VRI7 Q4VRI7_OXYSC unreviewed Alpha taipoxin-2 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 146 Q4VRH3 Q4VRH3_OXYSC unreviewed Lecithin retinol acyltransferase Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 511 Q7LZG4 Q7LZG4_OXYSC unreviewed Phospholipase A2 OS2 (EC 3.1.1.4) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 26 Q64G16 Q64G16_OXYSC unreviewed G protein-binding protein (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 197 Q64G10 Q64G10_OXYSC unreviewed Ribophorin (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 142 Q4VRH5 Q4VRH5_OXYSC unreviewed Uncharacterized protein Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 158 Q4QXK9 Q4QXK9_OXYSC unreviewed Carboxypeptidase (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 238 Q64G15 Q64G15_OXYSC unreviewed G protein-binding protein (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 199 Q4VRH4 Q4VRH4_OXYSC unreviewed Trafficking protein particle complex subunit Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 181 Q4VRH7 Q4VRH7_OXYSC unreviewed Elongation factor 2 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 406 Q64G11 Q64G11_OXYSC unreviewed Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (EC 2.4.99.18) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 201 Q1H621 Q1H621_OXYSC unreviewed Cytochrome c oxidase subunit 2 (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 222 Q4QXL1 Q4QXL1_OXYSC unreviewed Ca ATPase (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 123 Q4VRI4 Q4VRI4_OXYSC unreviewed OS6 Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 146 Q4QXL5 Q4QXL5_OXYSC unreviewed HSP 90 (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 468 Q64G14 Q64G14_OXYSC unreviewed Myosin light chain Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 172 Q64G13 Q64G13_OXYSC unreviewed Alpha actin (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 225 Q1H622 Q1H622_OXYSC unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 247 Q64G12 Q64G12_OXYSC unreviewed Beta actin (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 191 Q4VRH1 Q4VRH1_OXYSC unreviewed Cytochrome c oxidase subunit IV Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 170 Q3SB01 Q3SB01_OXYSU unreviewed 60S ribosomal protein P1 (Fragment) Oxyuranus scutellatus (Coastal taipan) 68 Q3SAZ6 Q3SAZ6_OXYSU unreviewed Mitochondrial protein L12-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 92 D2YVH9 D2YVH9_OXYSU unreviewed Venom C-type lectin mannose binding isoform 5 variant 1 Oxyuranus scutellatus (Coastal taipan) 157 D2YVI0 D2YVI0_OXYSU unreviewed Venom C-type lectin mannose binding isoform 5 variant 2 Oxyuranus scutellatus (Coastal taipan) 157 Q3SAY9 Q3SAY9_OXYSU unreviewed Adaptor-related protein complex delta subunit (Fragment) Oxyuranus scutellatus (Coastal taipan) 150 Q3SB00 Q3SB00_OXYSU unreviewed 40S ribosomal protein S2 (Fragment) Oxyuranus scutellatus (Coastal taipan) 253 Q3SB02 Q3SB02_OXYSU unreviewed 60S ribosomal protein L13a (Fragment) Oxyuranus scutellatus (Coastal taipan) 186 Q5MYC7 Q5MYC7_OXYSU unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 Oxyuranus scutellatus (Coastal taipan) 215 Q3SAY5 Q3SAY5_OXYSU unreviewed Muscle-derived protein 77-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 177 Q9PTC1 Q9PTC1_OXYSU unreviewed Phospholipase A2 inhibitor Oxyuranus scutellatus (Coastal taipan) 202 Q3SAY7 Q3SAY7_OXYSU unreviewed Helix-loop-helix transcription factor-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 82 Q3SAZ4 Q3SAZ4_OXYSU unreviewed Creatine kinase (Fragment) Oxyuranus scutellatus (Coastal taipan) 165 Q3SAY4 Q3SAY4_OXYSU unreviewed Neublin-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 291 A6MJH2 A6MJH2_OXYSU unreviewed Venom dipeptidylpeptidase IV Oxyuranus scutellatus (Coastal taipan) 753 Q45Z51 Q45Z51_OXYSU unreviewed PLA-3 Oxyuranus scutellatus (Coastal taipan) 154 Q5MYC8 Q5MYC8_OXYSU unreviewed Cytochrome b (Fragment) cytb Oxyuranus scutellatus (Coastal taipan) 224 Q78CF8 Q78CF8_OXYSU unreviewed Phospholipase A2 inhibitor Oxyuranus scutellatus (Coastal taipan) 202 Q3SAZ5 Q3SAZ5_OXYSU unreviewed Mitochondrial protein L47-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 82 D2YVH8 D2YVH8_OXYSU unreviewed Venom C-type lectin mannose binding isoform 3 Oxyuranus scutellatus (Coastal taipan) 172 B4YHJ5 B4YHJ5_OXYSU unreviewed Myosin heavy chain (Fragment) MYH2 Oxyuranus scutellatus (Coastal taipan) 37 Q3SAY3 Q3SAY3_OXYSU unreviewed Uncharacterized protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 50 B4YHF1 B4YHF1_OXYSU unreviewed C-mos (Fragment) Oxyuranus scutellatus (Coastal taipan) 210 Q3SAZ9 Q3SAZ9_OXYSU unreviewed 40S ribosomal protein S8 (Fragment) Oxyuranus scutellatus (Coastal taipan) 191 Q45Z50 Q45Z50_OXYSU unreviewed PLA-4 Oxyuranus scutellatus (Coastal taipan) 154 Q45Z48 Q45Z48_OXYSU unreviewed PLA-6 Oxyuranus scutellatus (Coastal taipan) 146 A8HDC4 A8HDC4_OXYSU unreviewed Cytochrome b (Fragment) Oxyuranus scutellatus (Coastal taipan) 242 Q38R58 Q38R58_OXYSU unreviewed NADH dehydrogenase subunit 4 (Fragment) ND4 Oxyuranus scutellatus (Coastal taipan) 214 Q3SAX9 Q3SAX9_OXYSU unreviewed Translocation protein SEC63-like protein (Fragment) Oxyuranus scutellatus (Coastal taipan) 309 Q3SAZ0 Q3SAZ0_OXYSU unreviewed Adenine nucleotide translocator (Fragment) Oxyuranus scutellatus (Coastal taipan) 148 Q3SAY1 Q3SAY1_OXYSU unreviewed SWI/SNF-related matrix-associated actin-dependent regulator of chromatin (Fragment) Oxyuranus scutellatus (Coastal taipan) 149 Q4QXL3 Q4QXL3_OXYSC unreviewed Venom oncogene (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 204 Q4QXL0 Q4QXL0_OXYSC unreviewed Golgi-associated protein (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 163 Q4QXL6 Q4QXL6_OXYSC unreviewed HSP 90 (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 191 Q4QXL2 Q4QXL2_OXYSC unreviewed Venom oncogene (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 233 Q4QXK7 Q4QXK7_OXYSC unreviewed Ribonuclease (EC 3.1.26.-) (Fragment) Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 211 Q4VRH6 Q4VRH6_OXYSC unreviewed Uncharacterized protein Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 136 Q45Z43 Q45Z43_OXYMI unreviewed PLA-3 Oxyuranus microlepidotus (Inland taipan) 146 B4YHJ4 B4YHJ4_OXYMI unreviewed Myosin heavy chain (Fragment) MYH2 Oxyuranus microlepidotus (Inland taipan) 46 Q9PTC7 Q9PTC7_OXYMI unreviewed Phospholipase A2 inhibitor Oxyuranus microlepidotus (Inland taipan) 201 D2YVL8 D2YVL8_OXYMI unreviewed Venom C-type lectin mannose binding isoform 3 variant 2 Oxyuranus microlepidotus (Inland taipan) 172 B5KFV6 B5KFV6_OXYMI unreviewed Microlepidotease-1 Oxyuranus microlepidotus (Inland taipan) 612 K7RW47 K7RW47_OXYMI unreviewed Prothrombin activator (Fragment) Oxyuranus microlepidotus (Inland taipan) 443 B2CAY2 B2CAY2_OXYMI unreviewed Oocyte maturation factor mos (Fragment) c-mos Oxyuranus microlepidotus (Inland taipan) 201 D2YVL6 D2YVL6_OXYMI unreviewed Venom C-type lectin mannose binding isoform 3 variant 3 Oxyuranus microlepidotus (Inland taipan) 172 Q45Z44 Q45Z44_OXYMI unreviewed PLA-2 Oxyuranus microlepidotus (Inland taipan) 146 B5G6F6 B5G6F6_OXYMI unreviewed SNTX-1 Oxyuranus microlepidotus (Inland taipan) 83 Q45Z41 Q45Z41_OXYMI unreviewed PLA-5 Oxyuranus microlepidotus (Inland taipan) 146 A6MJH3 A6MJH3_OXYMI unreviewed Venom dipeptidylpeptidase IV Oxyuranus microlepidotus (Inland taipan) 753 I6LJ72 I6LJ72_OXYMI unreviewed C-type lectin mannose binding isoform 5 variant 2 Oxyuranus microlepidotus (Inland taipan) 157 Q9PTB9 Q9PTB9_OXYMI unreviewed Phospholipase A2 inhibitor Oxyuranus microlepidotus (Inland taipan) 202 Q9PTC8 Q9PTC8_OXYMI unreviewed Phospholipase A2 inhibitor Oxyuranus microlepidotus (Inland taipan) 200 I6LJ71 I6LJ71_OXYMI unreviewed C-type lectin mannose binding isoform 5 variant 1 Oxyuranus microlepidotus (Inland taipan) 157 Q9PRI2 Q9PRI2_OXYMI unreviewed Phospholipase A2 inhibitor Oxyuranus microlepidotus (Inland taipan) 202 Q45Z45 Q45Z45_OXYMI unreviewed PLA-1 Oxyuranus microlepidotus (Inland taipan) 154 D2YVJ0 D2YVJ0_OXYMI unreviewed Venom C-type lectin mannose binding isoform 1 Oxyuranus microlepidotus (Inland taipan) 158 D2YVL7 D2YVL7_OXYMI unreviewed Venom C-type lectin mannose binding isoform 3 variant 1 Oxyuranus microlepidotus (Inland taipan) 172 tissue:wing =========== Entry Entry name Status Protein names Gene names Organism Length P08879 NDKA_DROME reviewed Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Abnormal wing disks protein) (Killer of prune protein) awd K-pn CG2210 Drosophila melanogaster (Fruit fly) 153 P17336 CATA_DROME reviewed Catalase (EC 1.11.1.6) Cat CG6871 Drosophila melanogaster (Fruit fly) 506 P11147 HSP7D_DROME reviewed Heat shock 70 kDa protein cognate 4 (Heat shock 70 kDa protein 88E) Hsc70-4 Hsc4 CG4264 Drosophila melanogaster (Fruit fly) 651 Q24342 FNG_DROME reviewed Fringe glycosyltransferase (EC 2.4.1.222) (O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) fng CG10580 Drosophila melanogaster (Fruit fly) 412 P29613 TPIS_DROME reviewed Triosephosphate isomerase (TIM) (EC 5.3.1.1) (Triose-phosphate isomerase) Tpi CG2171 Drosophila melanogaster (Fruit fly) 247 P35381 ATPA_DROME reviewed ATP synthase subunit alpha, mitochondrial (Protein bellwether) blw ATPSYN-ALPHA CG3612 Drosophila melanogaster (Fruit fly) 552 P15007 ENO_DROME reviewed Enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (2-phosphoglycerate dehydratase) Eno CG17654 Drosophila melanogaster (Fruit fly) 500 O02649 CH60_DROME reviewed 60 kDa heat shock protein, mitochondrial (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (Mitochondrial matrix protein P1) Hsp60 Mmp-P1 CG12101 Drosophila melanogaster (Fruit fly) 573 P25007 PPIA_DROME reviewed Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) (Cyclophilin) (Cyclosporin A-binding protein) (Rotamase) Cyp1 Cyp-1 CG9916 Drosophila melanogaster (Fruit fly) 227 P06604 TBA2_DROME reviewed Tubulin alpha-2 chain alphaTub85E TUBA85E CG9476 Drosophila melanogaster (Fruit fly) 449 P61857 TBB2_DROME reviewed Tubulin beta-2 chain (Beta-2-tubulin) betaTub85D TubB85D CG9359 Drosophila melanogaster (Fruit fly) 446 Q9VDD3 SNMP1_DROME reviewed Sensory neuron membrane protein 1 (SNMP1Dmel) Snmp1 CG7000 Drosophila melanogaster (Fruit fly) 551 B1B557 NOSL_BOMMO reviewed Nitric oxide synthase-like protein (EC 1.14.13.39) NSL Bombyx mori (Silk moth) 1097 P52273 TBA_BOMMO reviewed Tubulin alpha chain Bombyx mori (Silk moth) 450 P08736 EF1A1_DROME reviewed Elongation factor 1-alpha 1 (EF-1-alpha-1) (50 kDa female-specific protein) Ef1alpha48D EF1B F1 CG8280 Drosophila melanogaster (Fruit fly) 463 Q9BLC5 HSP83_BOMMO reviewed Heat shock protein 83 (BmHSP90) Hsp83 Hsp90 Bombyx mori (Silk moth) 716 Q957A7 CYB_MYOMA reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis macrotarsus (Philippine large-footed myotis) 379 Q5F4F4 CYB_NEOCP reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Neoromicia capensis (Cape serotine bat) (Eptesicus capensis) 379 O21217 CYB_PIPKU reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Pipistrellus kuhlii (Kuhl's pipistrelle) 379 Q5F4E4 CYB_MINFR reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Miniopterus fraterculus (Lesser long-fingered bat) 379 Q7Y8L0 CYB_MYORI reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis ricketti (Rickett's big-footed bat) 379 Q5F4F1 CYB_PIPHE reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Pipistrellus hesperidus (African pipistrelle) (Dusky pipistrelle) 379 Q5F4E8 CYB_HARMO reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Harpiocephalus mordax (Greater hairy-winged bat) (Harpiocephalus harpia mordax) 379 Q5F4G3 CYB_MYOAC reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis alcathoe (Alcathoe's myotis) 379 Q5F4G7 CYB_MYOSA reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis sicarius (Mandelli's mouse-eared bat) 379 Q7YBY4 CYB_MYOTR reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis tricolor (Cape hairy bat) (Temminck's myotis) 379 Q5UAP4 RSSA_BOMMO reviewed 40S ribosomal protein SA Bombyx mori (Silk moth) 306 Q7YD72 CYB_MYOGO reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis goudoti (Malagasy mouse-eared bat) 379 O21220 CYB_PIPNA reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Pipistrellus nathusii (Nathusius' pipistrelle) 379 P11733 CU07_LOCMI reviewed Cuticle protein 7 (LM-ACP 7) (LM-7) Locusta migratoria (Migratory locust) 131 P45584 CU63_LOCMI reviewed Cuticle protein 63 (LM-ACP 63) (LM-63) Locusta migratoria (Migratory locust) 157 P11739 CU64_LOCMI reviewed Cuticle protein 64 (LM-ACP 64) (LM-64) Locusta migratoria (Migratory locust) 152 P45587 CU79B_LOCMI reviewed Cuticle protein 79, isoform B (LM-ACP 79B) (LM-79B) Locusta migratoria (Migratory locust) 131 Q7YD75 CYB_PIPAB reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Pipistrellus abramus (Japanese pipistrelle) (Pipistrellus javanicus abramus) 379 Q5F4G2 CYB_MYOAN reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis annectans (Hairy-faced bat) 379 Q5F4G9 CYB_MYOEV reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis evotis (Long-eared myotis) (Western long-eared bat) 379 Q7YBY6 CYB_MYOVI reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Myotis vivesi (Fish-eating bat) (Pizonyx vivesi) 379 P45583 CU19_LOCMI reviewed Cuticle protein 19 (LM-ACP 19) (LM-19) Locusta migratoria (Migratory locust) 157 P45585 CU65_LOCMI reviewed Cuticle protein 65 (LM-ACP 65) (LM-65) Locusta migratoria (Migratory locust) 145 Q5F4F5 CYB_LAEWI reviewed Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) MT-CYB COB CYTB MTCYB Laephotis wintoni (De Winton's long-eared bat) 379 P45586 CU79A_LOCMI reviewed Cuticle protein 79, isoform A (LM-ACP 79A) (LM-79A) Locusta migratoria (Migratory locust) 131 H9BVN4 H9BVN4_NASVI unreviewed Unpaired-like2 protein (Fragment) Nasonia vitripennis (Parasitic wasp) 187 I2DBN0 I2DBN0_9INSE unreviewed Histone H3 (Fragment) Cinygmula sp. OPU_BS_C2011-90 109 C0SUF3 C0SUF3_ACHDO unreviewed Ecdysone receptor B1 isoform (Fragment) EcR-B1 Acheta domesticus (House cricket) 213 V5QR63 V5QR63_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Cinygmula sp. OPU_BS_C2011-91 219 I2DBJ1 I2DBJ1_9INSE unreviewed Histone H3 (Fragment) Cinygmula sp. OPU_BS_C2011-91 109 Q9U0R9 Q9U0R9_JUNCO unreviewed Ecdysteroid receptor (Fragment) ecr Junonia coenia (Peacock butterfly) (Precis coenia) 339 I4DN63 I4DN63_PAPPL unreviewed Bilin binding protein 4 Papilio polytes (Common mormon) (Swallowtail butterfly) 198 F2Z7K8 F2Z7K8_BOMMO unreviewed Apterous B beta Bmap-B Bombyx mori (Silk moth) 159 C5NS72 C5NS72_BOMMO unreviewed Enhancer of split malpha (Fragment) E(spl)malpha Bombyx mori (Silk moth) 143 O76149 O76149_BOMMO unreviewed Tubulin beta chain Bombyx mori (Silk moth) 447 C5NS66 C5NS66_BOMMO unreviewed Delta-like protein (Fragment) Ser Bombyx mori (Silk moth) 194 F2Z8A0 F2Z8A0_BOMMO unreviewed Apterous A splicing isoform type E Bmap-A Bombyx mori (Silk moth) 237 F8WSN3 F8WSN3_BOMMO unreviewed Nuclear hormone receptor BFTZ-F1 Bombyx mori (Silk moth) 541 F2Z8A1 F2Z8A1_BOMMO unreviewed Apterous A splicing isoform type F Bmap-A Bombyx mori (Silk moth) 80 Q75T82 Q75T82_BOMMO unreviewed Protein tyrosine phosphatase Bmptp-h Bombyx mori (Silk moth) 212 C5NS65 C5NS65_BOMMO unreviewed Delta-like protein Dl Bombyx mori (Silk moth) 728 L0N4M0 L0N4M0_BOMMO unreviewed Cytochrome P450 (Fragment) CYP18A1 Bombyx mori (Silk moth) 204 A0A0H5AGH4 A0A0H5AGH4_BOMMO unreviewed E75 D isoform E75D Bombyx mori (Silk moth) 606 F2Z7K5 F2Z7K5_BOMMO unreviewed Bmptp-Z and Bmap-A fusion protein beta Bombyx mori (Silk moth) 444 B1B559 B1B559_BOMMO unreviewed Fringe fng Bombyx mori (Silk moth) 327 F2Z898 F2Z898_BOMMO unreviewed Apterous A splicing isoform type C Bmap-A Bombyx mori (Silk moth) 385 B5BSX8 B5BSX8_BOMMO unreviewed Beta-1,3-glucan recognition protein 3 bGRP3 Bombyx mori (Silk moth) 489 F2Z7K6 F2Z7K6_BOMMO unreviewed Bmptp-Z and Bmap-A fusion protein gamma Bombyx mori (Silk moth) 148 L0N5H8 L0N5H8_BOMMO unreviewed Cytochrome P450 (Fragment) CYP18A1 Bombyx mori (Silk moth) 453 C5NS70 C5NS70_BOMMO unreviewed Enhancer of split mbeta-2 (Fragment) E(spl)mbeta-2 Bombyx mori (Silk moth) 163 L0N4S4 L0N4S4_BOMMO unreviewed Cytochrome P450 CYP6AB4 Bombyx mori (Silk moth) 511 Q8WPH2 Q8WPH2_BOMMO unreviewed Wing disc-specific protein CB10 Bombyx mori (Silk moth) 1155 C5NS64 C5NS64_BOMMO unreviewed Notch N Bombyx mori (Silk moth) 2463 C5NS69 C5NS69_BOMMO unreviewed Enhancer of split mbeta (Fragment) E(spl)mbeta Bombyx mori (Silk moth) 169 O77057 O77057_BOMMO unreviewed Cuticle protein Bombyx mori (Silk moth) 197 Q9U5G5 Q9U5G5_BOMMO unreviewed Apterous (Fragment) APTEROUS Bombyx mori (Silk moth) 62 L0N5M4 L0N5M4_BOMMO unreviewed Cytochrome P450 CYP49A1 Bombyx mori (Silk moth) 540 Q9U5G7 Q9U5G7_BOMMO unreviewed Ribosomal protein L3 (Fragment) RPL3 Bombyx mori (Silk moth) 171 F2Z897 F2Z897_BOMMO unreviewed Apterous A splicing isoform type B Bmap-A Bombyx mori (Silk moth) 398 Q8WPG4 Q8WPG4_BOMMO unreviewed UDP-glucuronosyltransferase (EC 2.4.1.17) Bombyx mori (Silk moth) 520 F2Z7K4 F2Z7K4_BOMMO unreviewed Bmptp-Z and Bmap-A fusion protein alpha Bombyx mori (Silk moth) 466 Q8WPH0 Q8WPH0_BOMMO unreviewed Annexin Anxb13 Bombyx mori (Silk moth) 486 Q8WPG9 Q8WPG9_BOMMO unreviewed Annexin Anxb13 Bombyx mori (Silk moth) 321 Q8I6Y0 Q8I6Y0_BOMMO unreviewed Cuticle protein BMWCP10 Bombyx mori (Silk moth) 311 C5NS71 C5NS71_BOMMO unreviewed Enhancer of split mgamma (Fragment) E(spl)mgamma Bombyx mori (Silk moth) 160 L0N5I8 L0N5I8_BOMMO unreviewed Cytochrome P450 CYP314A1 Bombyx mori (Silk moth) 462 Q17208 Q17208_BOMMO unreviewed Collagen (Fragment) Bombyx mori (Silk moth) 569 F2Z7K7 F2Z7K7_BOMMO unreviewed Apterous B alpha Bmap-B Bombyx mori (Silk moth) 349 Q8WPH3 Q8WPH3_BOMMO unreviewed Fibrillin-like protein AD10 Bombyx mori (Silk moth) 580 Q17249 Q17249_BOMMO unreviewed Urbain Bombyx mori (Silk moth) 551 Q9U5G6 Q9U5G6_BOMMO unreviewed Hormone receptor 3 (Fragment) BHR3 Bombyx mori (Silk moth) 171 O01676 O01676_BOMMO unreviewed Tubulin beta chain Bombyx mori (Silk moth) 447 F2Z899 F2Z899_BOMMO unreviewed Apterous A splicing isoform type D Bmap-A Bombyx mori (Silk moth) 259 I2DBL7 I2DBL7_9INSE unreviewed Histone H3 (Fragment) Rhithrogena sp. OPU_BS_R2010-16 109 V5QNX1 V5QNX1_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena sp. OPU_BS_R2010-16 219 H9BVN3 H9BVN3_9HYME unreviewed Unpaired-like protein (Fragment) Nasonia giraulti 275 I4DN64 I4DN64_PAPPL unreviewed Bilin binding protein 5 Papilio polytes (Common mormon) (Swallowtail butterfly) 202 C6KEM2 C6KEM2_HELME unreviewed Karmoisin (Fragment) kar Heliconius melpomene cythera 370 V5QNY1 V5QNY1_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Cinygmula sp. OPU_BS_C2011-90 219 V5QR69 V5QR69_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Potamanthus idiocerus 219 I2DBK0 I2DBK0_9INSE unreviewed Histone H3 (Fragment) Baetis sp. OPU_BS_B2011-19 109 V5QNU5 V5QNU5_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Paraleptophlebia japonica 219 K9MLM1 K9MLM1_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena japonica 219 V5QR53 V5QR53_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena sp. OPU_BS_R2010-19 219 V5QPX6 V5QPX6_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena sp. OPU_BS_R2010-12 219 Q2EJS5 Q2EJS5_DROME unreviewed Nubbin (Fragment) Drosophila melanogaster (Fruit fly) 290 I2DBL4 I2DBL4_9INSE unreviewed Histone H3 (Fragment) Ameletus sp. OPU_BS_A2010-10 109 O96435 O96435_DROME unreviewed Tyrosine kinase receptor protein Eph eph CG1511 Drosophila melanogaster (Fruit fly) 1019 V5QNX9 V5QNX9_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Ephemerella sp. OPU_BS_E2012-129 219 V5QNQ1 V5QNQ1_9INSE unreviewed Histone H3 (Fragment) Ephemerella sp. OPU_BS_E2012-129 109 H9BVN5 H9BVN5_NASVI unreviewed Uncharacterized protein (Fragment) Nasonia vitripennis (Parasitic wasp) 96 V5QP74 V5QP74_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Epeorus curvatulus 219 A0A097P6B3 A0A097P6B3_PTESM unreviewed Long wavelength sensitive opsin (Fragment) OPNLW1 Pteropus samoensis (Samoan flying fox) 133 A0A097P697 A0A097P697_PTESM unreviewed Short-wavelength sensitive opsin (Fragment) OPNSW1 Pteropus samoensis (Samoan flying fox) 123 Q5F4F2 Q5F4F2_NYCNO unreviewed Cytochrome b (Fragment) cyt b Nyctalus noctula (Noctule bat) 371 V5QNV2 V5QNV2_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Ameletus costalis 219 C1JE12 C1JE12_PTEVA unreviewed Cytochrome b (Fragment) cytb Pteropus vampyrus (Large flying fox) 377 A0A0K0LD03 A0A0K0LD03_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD22 A0A0K0LD22_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA8 A0A0K0LDA8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD89 A0A0K0LD89_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD44 A0A0K0LD44_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCX9 A0A0K0LCX9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ5 A0A0K0LCZ5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDL1 A0A0K0LDL1_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD29 A0A0K0LD29_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD10 A0A0K0LD10_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDP8 A0A0K0LDP8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDQ7 A0A0K0LDQ7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD05 A0A0K0LD05_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCY6 A0A0K0LCY6_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA9 A0A0K0LDA9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ8 A0A0K0LCZ8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD45 A0A0K0LD45_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB2 A0A0K0LDB2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD67 A0A0K0LD67_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD26 A0A0K0LD26_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD11 A0A0K0LD11_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK7 A0A0K0LDK7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 Q5F4F0 Q5F4F0_9CHIR unreviewed Cytochrome b cyt b Kerivoula cf. papillosa 379 A0A0K0LCZ4 A0A0K0LCZ4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ1 A0A0K0LCZ1_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD18 A0A0K0LD18_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD88 A0A0K0LD88_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD24 A0A0K0LD24_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD92 A0A0K0LD92_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDR2 A0A0K0LDR2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDC7 A0A0K0LDC7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB7 A0A0K0LDB7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD97 A0A0K0LD97_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD56 A0A0K0LD56_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ1 A0A0K0LDJ1_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD83 A0A0K0LD83_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB4 A0A0K0LDB4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD07 A0A0K0LD07_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ5 A0A0K0LDJ5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD73 A0A0K0LD73_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD76 A0A0K0LD76_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD13 A0A0K0LD13_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD21 A0A0K0LD21_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD12 A0A0K0LD12_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ2 A0A0K0LDJ2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ9 A0A0K0LCZ9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ6 A0A0K0LCZ6_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD98 A0A0K0LD98_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB5 A0A0K0LDB5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA5 A0A0K0LDA5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA0 A0A0K0LDA0_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD16 A0A0K0LD16_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD64 A0A0K0LD64_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD00 A0A0K0LD00_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD59 A0A0K0LD59_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ7 A0A0K0LCZ7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB0 A0A0K0LDB0_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD14 A0A0K0LD14_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD04 A0A0K0LD04_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDC4 A0A0K0LDC4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD41 A0A0K0LD41_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDN3 A0A0K0LDN3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD51 A0A0K0LD51_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD63 A0A0K0LD63_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD09 A0A0K0LD09_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD46 A0A0K0LD46_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD08 A0A0K0LD08_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCY4 A0A0K0LCY4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ9 A0A0K0LDJ9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD33 A0A0K0LD33_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ3 A0A0K0LCZ3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDM7 A0A0K0LDM7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A172SP25 A0A172SP25_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 233 A0A172SNJ1 A0A172SNJ1_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 182 V5V0B4 V5V0B4_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi darlingi 316 V5UZB4 V5UZB4_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi darlingi 316 C1JDY7 C1JDY7_PTECN unreviewed Cytochrome b cytb Pteropus conspicillatus (Spectacled flying fox) 379 A0A172SP02 A0A172SP02_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 215 V5V0E3 V5V0E3_9CHIR unreviewed Cytochrome b (Fragment) cytb Rhinolophus swinnyi (Swinny's horseshoe bat) 316 V5V1M2 V5V1M2_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi darlingi 316 A0A172SNT5 A0A172SNT5_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 233 A0A172SP36 A0A172SP36_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 233 A0A172SP34 A0A172SP34_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 224 J3JRY8 J3JRY8_EPTHO unreviewed Cytochrome b cyt b Eptesicus hottentotus (Long-tailed house bat) 379 C1JE10 C1JE10_PTEVA unreviewed Cytochrome b cytb Pteropus vampyrus (Large flying fox) 379 A0A172SNS6 A0A172SNS6_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 234 A0A172SP08 A0A172SP08_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 223 V5V0E6 V5V0E6_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi darlingi 17 C1JDY8 C1JDY8_PTECN unreviewed Cytochrome b cytb Pteropus conspicillatus (Spectacled flying fox) 379 A0A172SP19 A0A172SP19_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 139 C1JDY9 C1JDY9_PTECN unreviewed Cytochrome b cytb Pteropus conspicillatus (Spectacled flying fox) 379 A0A172SNL3 A0A172SNL3_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 205 C1JE11 C1JE11_PTEVA unreviewed Cytochrome b (Fragment) cytb Pteropus vampyrus (Large flying fox) 377 V5V093 V5V093_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi darlingi 316 A0A172SP49 A0A172SP49_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 110 A0A172SNN8 A0A172SNN8_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 167 A0A172SNV0 A0A172SNV0_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 149 V5V1N8 V5V1N8_9CHIR unreviewed Cytochrome b (Fragment) cytb Rhinolophus simulator (Bushveld horseshoe bat) 316 V5V0A9 V5V0A9_9CHIR unreviewed Cytochrome b (Fragment) cytb Rhinolophus blasii (Blasius's horseshoe bat) 316 A0A172SNH0 A0A172SNH0_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 234 A0A0D3MBK3 A0A0D3MBK3_MINSC unreviewed Cytochrome b (Fragment) Cyt b Miniopterus schreibersii pallidus 228 A0A1W6AY11 A0A1W6AY11_9CHIR unreviewed Cytochrome b (Fragment) cytb Hipposideros fulvus (Fulvus leaf-nosed bat) 144 V5UZB2 V5UZB2_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi barbetonensis 316 Q5F4F6 Q5F4F6_CISSE unreviewed Cytochrome b cyt b Cistugo seabrae (Angolan hairy bat) (Myotis seabrai) 379 C1JDZ3 C1JDZ3_PTELI unreviewed Cytochrome b cytb Pteropus livingstonii (Comoro flying fox) 379 V5V058 V5V058_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V1M4 V5V1M4_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V064 V5V064_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V0F2 V5V0F2_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 18 Q5F4F7 Q5F4F7_CISLE unreviewed Cytochrome b cyt b Cistugo lesueuri (Lesueur's hairy bat) (Myotis lesueuri) 379 V5V075 V5V075_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5UZB9 V5UZB9_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V0D3 V5V0D3_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V0C3 V5V0C3_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 A0A2D0WSY6 A0A2D0WSY6_9CHIR unreviewed Cytochrome b (Fragment) cytb Hipposideros lankadiva (Indian leaf-nosed bat) 270 A0A1D8BNK7 A0A1D8BNK7_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 V5UZD2 V5UZD2_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 18 V5UZC3 V5UZC3_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V0B7 V5V0B7_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 17 V5V0B9 V5V0B9_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5UZC8 V5UZC8_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 17 V5V069 V5V069_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V0B0 V5V0B0_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V0D1 V5V0D1_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 C1JDZ4 C1JDZ4_PTENR unreviewed Cytochrome b (Fragment) cytb Pteropus niger (Mauritian flying fox) (Greater Mascarene flying fox) 341 A0A140INH2 A0A140INH2_9CHIR unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus coibensis (Coiban mastiff bat) 219 Q5F4G1 Q5F4G1_MYOMU unreviewed Cytochrome b cyt b Myotis muricola (Nepalese whiskered bat) (Vespertilio muricola) 379 A0A2D0WSU6 A0A2D0WSU6_9CHIR unreviewed Cytochrome b (Fragment) cytb Hipposideros durgadasi 374 A0A0K0LD57 A0A0K0LD57_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK0 A0A0K0LDK0_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD01 A0A0K0LD01_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDL2 A0A0K0LDL2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD86 A0A0K0LD86_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDP3 A0A0K0LDP3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD32 A0A0K0LD32_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD15 A0A0K0LD15_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD31 A0A0K0LD31_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD99 A0A0K0LD99_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD50 A0A0K0LD50_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD90 A0A0K0LD90_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDR6 A0A0K0LDR6_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD62 A0A0K0LD62_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD79 A0A0K0LD79_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD52 A0A0K0LD52_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD69 A0A0K0LD69_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD66 A0A0K0LD66_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDL0 A0A0K0LDL0_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD81 A0A0K0LD81_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD61 A0A0K0LD61_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDL9 A0A0K0LDL9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDD7 A0A0K0LDD7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD43 A0A0K0LD43_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD36 A0A0K0LD36_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA2 A0A0K0LDA2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD17 A0A0K0LD17_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD25 A0A0K0LD25_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDC2 A0A0K0LDC2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD60 A0A0K0LD60_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD39 A0A0K0LD39_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCY2 A0A0K0LCY2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCX5 A0A0K0LCX5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK6 A0A0K0LDK6_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD49 A0A0K0LD49_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD53 A0A0K0LD53_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDQ2 A0A0K0LDQ2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD54 A0A0K0LD54_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 Q5F4G4 Q5F4G4_MYOWE unreviewed Cytochrome b cyt b Myotis welwitschii (Welwitsch's bat) 379 Q5F4G8 Q5F4G8_MYOFO unreviewed Cytochrome b cyt b Myotis formosus (Hodgson's bat) (Copper-winged bat) 379 C1JDZ5 C1JDZ5_PTEPO unreviewed Cytochrome b (Fragment) cytb Pteropus poliocephalus (Grey-headed flying fox) 366 Q5F4E9 Q5F4E9_9CHIR unreviewed Cytochrome b cyt b Kerivoula cf. papillosa 379 A0A0K0LDJ3 A0A0K0LDJ3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD85 A0A0K0LD85_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD95 A0A0K0LD95_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ4 A0A0K0LDJ4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA3 A0A0K0LDA3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD23 A0A0K0LD23_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCY5 A0A0K0LCY5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD71 A0A0K0LD71_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD47 A0A0K0LD47_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD94 A0A0K0LD94_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD42 A0A0K0LD42_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDM3 A0A0K0LDM3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD48 A0A0K0LD48_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD37 A0A0K0LD37_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCY7 A0A0K0LCY7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD78 A0A0K0LD78_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB9 A0A0K0LDB9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA7 A0A0K0LDA7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD77 A0A0K0LD77_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD02 A0A0K0LD02_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD20 A0A0K0LD20_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD06 A0A0K0LD06_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK5 A0A0K0LDK5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ6 A0A0K0LDJ6_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD58 A0A0K0LD58_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDN8 A0A0K0LDN8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD74 A0A0K0LD74_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD82 A0A0K0LD82_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD30 A0A0K0LD30_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD55 A0A0K0LD55_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 M4LY61 M4LY61_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 M4LXS6 M4LXS6_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 Q7YBY5 Q7YBY5_MYOVI unreviewed Cytochrome b cytb Myotis vivesi (Fish-eating bat) (Pizonyx vivesi) 379 M4LY56 M4LY56_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 M4M4Q6 M4M4Q6_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 A0A140ING0 A0A140ING0_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 M4M4Q1 M4M4Q1_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 M4LY69 M4LY69_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 A0A140INI4 A0A140INI4_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 M4LZL2 M4LZL2_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 Q5F4E2 Q5F4E2_MINNA unreviewed Cytochrome b cyt b Miniopterus natalensis (Natal long-fingered bat) (Miniopterus schreibersii natalensis) 379 Q5F4G5 Q5F4G5_MYOTR unreviewed Cytochrome b cyt b Myotis tricolor (Cape hairy bat) (Temminck's myotis) 379 C1JDZ7 C1JDZ7_PTEPU unreviewed Cytochrome b cytb Pteropus pumilus (Little golden-mantled flying fox) 379 V5V0J1 V5V0J1_9CHIR unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus fumigatus (Rueppell's horseshoe bat) 17 A0A0K0LDJ8 A0A0K0LDJ8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDL5 A0A0K0LDL5_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD35 A0A0K0LD35_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD38 A0A0K0LD38_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB3 A0A0K0LDB3_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD27 A0A0K0LD27_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDI9 A0A0K0LDI9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD28 A0A0K0LD28_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK9 A0A0K0LDK9_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDB8 A0A0K0LDB8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK4 A0A0K0LDK4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD34 A0A0K0LD34_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDJ7 A0A0K0LDJ7_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCY8 A0A0K0LCY8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD72 A0A0K0LD72_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD40 A0A0K0LD40_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD68 A0A0K0LD68_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDK8 A0A0K0LDK8_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDD2 A0A0K0LDD2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LDA4 A0A0K0LDA4_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD19 A0A0K0LD19_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD93 A0A0K0LD93_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LCZ2 A0A0K0LCZ2_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 A0A0K0LD65 A0A0K0LD65_ARTJA unreviewed MHC class II antigen (Fragment) Arja-DRB Artibeus jamaicensis (Jamaican fruit-eating bat) 72 M4LXT1 M4LXT1_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 A0A127M0N0 A0A127M0N0_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 M4LXU1 M4LXU1_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 M4M1E3 M4M1E3_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 A0A127M0M7 A0A127M0M7_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 Q5F4E3 Q5F4E3_MINNA unreviewed Cytochrome b cyt b Miniopterus natalensis (Natal long-fingered bat) (Miniopterus schreibersii natalensis) 379 A0A172SP05 A0A172SP05_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 234 V5UZB7 V5UZB7_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 G1B1E2 G1B1E2_9CHIR unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus coibensis (Coiban mastiff bat) 219 A0A127M0K9 A0A127M0K9_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 V5V1S8 V5V1S8_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 17 C1JE13 C1JE13_9CHIR unreviewed Cytochrome b (Fragment) cytb Pteropus voeltzkowi (Pemba flying fox) 341 A0A1D8BNA4 A0A1D8BNA4_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNX6 A0A1D8BNX6_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNV3 A0A1D8BNV3_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNC8 A0A1D8BNC8_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BP29 A0A1D8BP29_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNR1 A0A1D8BNR1_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNU3 A0A1D8BNU3_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNZ6 A0A1D8BNZ6_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A140ING7 A0A140ING7_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 M4LY39 M4LY39_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 V5UZD0 V5UZD0_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 17 A0A172SNZ2 A0A172SNZ2_CHATU unreviewed Cytochrome b (Fragment) CYB Chalinolobus tuberculatus (New Zealand long-tailed bat) 214 V5V1S0 V5V1S0_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 18 V5UZC1 V5UZC1_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 A0A1D8BNT0 A0A1D8BNT0_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNS0 A0A1D8BNS0_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BP19 A0A1D8BP19_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 M4M1D8 M4M1D8_CORTO unreviewed Cytochrome b (Fragment) cytb Corynorhinus townsendii australis 316 C1JDZ1 C1JDZ1_PTEHP unreviewed Cytochrome b cytb Pteropus hypomelanus (Island flying fox) (Variable flying fox) 379 A0A0D3MBW2 A0A0D3MBW2_MINSC unreviewed Cytochrome b (Fragment) Cyt b Miniopterus schreibersii pallidus 228 V5V0G4 V5V0G4_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi damarensis 18 V5V1N0 V5V1N0_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 V5V1M6 V5V1M6_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi damarensis 316 C1JDZ8 C1JDZ8_PTEPU unreviewed Cytochrome b cytb Cytb Pteropus pumilus (Little golden-mantled flying fox) 379 S6A111 S6A111_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZH85 S5ZH85_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZNE5 S5ZNE5_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHL1 S5ZHL1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A1L9 S6A1L9_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 V5V090 V5V090_RHIDA unreviewed Cytochrome b (Fragment) cytb Rhinolophus darlingi darlingi 316 S6A1G5 S6A1G5_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZV57 S5ZV57_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZV17 S5ZV17_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZP41 S5ZP41_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHN7 S5ZHN7_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7C3 S6A7C3_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 V5UZC5 V5UZC5_RHIDA unreviewed Putative thyrotropin beta chain (Fragment) THY Rhinolophus darlingi darlingi 17 S6A799 S6A799_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7H2 S6A7H2_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 Q5F4E5 Q5F4E5_9CHIR unreviewed Cytochrome b cyt b Murina cf. cyclotis 379 S6A7E4 S6A7E4_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHW1 S5ZHW1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 367 S6A7B5 S6A7B5_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 Q5F4E7 Q5F4E7_9CHIR unreviewed Cytochrome b cyt b Murina cf. cyclotis 379 S6A7A6 S6A7A6_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHD1 S5ZHD1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZNV6 S5ZNV6_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZH40 S5ZH40_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7C6 S6A7C6_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7B1 S6A7B1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7E3 S6A7E3_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZV00 S5ZV00_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZPL0 S5ZPL0_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A1G1 S6A1G1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZV14 S5ZV14_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 Q5F4E6 Q5F4E6_9CHIR unreviewed Cytochrome b cyt b Murina cf. cyclotis 379 S5ZUY5 S5ZUY5_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZPK1 S5ZPK1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7A7 S6A7A7_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHS1 S5ZHS1_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7D0 S6A7D0_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 A0A1D8BN62 A0A1D8BN62_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNB5 A0A1D8BNB5_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A1D8BNZ9 A0A1D8BNZ9_DESRO unreviewed Cytochrome b (Fragment) cytb Desmodus rotundus (Vampire bat) 377 A0A127M0K1 A0A127M0K1_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 A3R2B6 A3R2B6_MOLMO unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Molossus molossus (Pallas' mastiff bat) (Vespertilio molossus) 219 I2DBK8 I2DBK8_9INSE unreviewed Histone H3 (Fragment) Ameletus sp. OPU_BS_A2011-106 109 I2DBN2 I2DBN2_9INSE unreviewed Histone H3 (Fragment) Cincticostella sp. OPU_BS_C2011-113 109 V5QPX2 V5QPX2_9INSE unreviewed Histone H3 (Fragment) Cincticostella sp. OPU_BS_C2011-117 109 C1JDZ0 C1JDZ0_PTEGI unreviewed Cytochrome b (Fragment) cytb Pteropus giganteus (Indian flying fox) 378 V5V084 V5V084_9CHIR unreviewed Cytochrome b (Fragment) cytb Rhinolophus denti (Dent's horseshoe bat) 316 C1JE06 C1JE06_9CHIR unreviewed Cytochrome b (Fragment) cytb Pteropus seychellensis comorensis 376 C1JE05 C1JE05_9CHIR unreviewed Cytochrome b (Fragment) cytb Pteropus seychellensis comorensis 376 C1JE04 C1JE04_9CHIR unreviewed Cytochrome b (Fragment) cytb Pteropus seychellensis comorensis 376 C1JE02 C1JE02_PTERF unreviewed Cytochrome b (Fragment) cytb Pteropus rufus (Madagascan flying fox) 340 C1JE07 C1JE07_9CHIR unreviewed Cytochrome b (Fragment) cytb Pteropus seychellensis comorensis 376 C1JE00 C1JE00_PTERO unreviewed Cytochrome b (Fragment) cytb Pteropus rodricensis (Rodriguez flying fox) 379 C1JE01 C1JE01_PTERO unreviewed Cytochrome b cytb Pteropus rodricensis (Rodriguez flying fox) 379 Q7YD76 Q7YD76_9CHIR unreviewed Cytochrome b cytb Pipistrellus cf. javanicus 379 C1JE03 C1JE03_9CHIR unreviewed Cytochrome b cytb Pteropus aldabrensis (Aldabra flying fox) 379 S5ZP10 S5ZP10_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A192 S6A192_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7A9 S6A7A9_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHB9 S5ZHB9_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZP02 S5ZP02_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A162 S6A162_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZNT8 S5ZNT8_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZP26 S5ZP26_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A189 S6A189_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZVC0 S5ZVC0_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZNR8 S5ZNR8_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A194 S6A194_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZNK3 S5ZNK3_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S6A7F4 S6A7F4_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHJ2 S5ZHJ2_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZVL7 S5ZVL7_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZPC9 S5ZPC9_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 A0A0D3MBI0 A0A0D3MBI0_MYOBL unreviewed Cytochrome b (Fragment) Cyt b Myotis blythii (Lesser mouse-eared bat) 226 S5ZVC2 S5ZVC2_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZPN3 S5ZPN3_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZPJ5 S5ZPJ5_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 S5ZHI7 S5ZHI7_RHIHI unreviewed Cytochrome b (Fragment) CYTB Rhinolophus hipposideros (Lesser horseshoe bat) 368 Q9NDS8 Q9NDS8_BOMMO unreviewed Angiotensin-converting enzyme (EC 3.4.-.-) BmAcer Bombyx mori (Silk moth) 648 Q1KLR9 Q1KLR9_BOMMO unreviewed Transcription factor (Transcription factor E74 isoform B) E74B Bombyx mori (Silk moth) 286 I2DBJ4 I2DBJ4_9INSE unreviewed Histone H3 (Fragment) Cincticostella elongatula 109 E2DZL8 E2DZL8_HELME unreviewed Opsin (Ultraviolet-sensitive visual pigment) UVRh2 Heliconius melpomene (Postman butterfly) 378 I2DBM6 I2DBM6_9INSE unreviewed Histone H3 (Fragment) Epeorus latifolium 109 I2E668 I2E668_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Epeorus latifolium 219 W5QM97 W5QM97_BICAN unreviewed Delta11-desaturase Bicyclus anynana (Squinting bush brown butterfly) 328 Q5S6Z5 Q5S6Z5_BICAN unreviewed Ruby (Fragment) Bicyclus anynana (Squinting bush brown butterfly) 136 W5QM70 W5QM70_BICAN unreviewed Fatty acyl-CoA reductase (EC 1.2.1.84) FAR2 Bicyclus anynana (Squinting bush brown butterfly) 478 Q9U3U4 Q9U3U4_BICAN unreviewed Ecdysteroid receptor (Fragment) ecr Bicyclus anynana (Squinting bush brown butterfly) 346 Q5S6Z7 Q5S6Z7_BICAN unreviewed Vermilion (Fragment) Bicyclus anynana (Squinting bush brown butterfly) 175 W5QMH3 W5QMH3_BICAN unreviewed Fatty acyl-CoA reductase (EC 1.2.1.84) FAR1 Bicyclus anynana (Squinting bush brown butterfly) 443 H8YI03 H8YI03_SPOLT unreviewed Nucleoside diphosphate kinase (EC 2.7.4.6) Spodoptera litura (Asian cotton leafworm) 178 Q5S6Z8 Q5S6Z8_BICAN unreviewed Henna (Fragment) Bicyclus anynana (Squinting bush brown butterfly) 125 H9JLM8 H9JLM8_BOMMO unreviewed Cytochrome P450 CYP338A1 Bombyx mori (Silk moth) 464 A3RKJ4 A3RKJ4_BOMMO unreviewed Cytochrome P450 CYP18A1 Cyp18a1 Bombyx mori (Silk moth) 541 V5QP85 V5QP85_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Afronurus hyalinus 219 V5QPQ4 V5QPQ4_9INSE unreviewed Histone H3 (Fragment) Potamanthus idiocerus 109 I2DBM0 I2DBM0_9INSE unreviewed Histone H3 (Fragment) Baetiella japonica 109 V5QPY1 V5QPY1_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Baetiella japonica 219 K9MMF9 K9MMF9_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena japonica 219 I2DBL2 I2DBL2_9INSE unreviewed Histone H3 (Fragment) Rhithrogena tateyamana 109 W5QMG3 W5QMG3_BICAN unreviewed Delta 9 desaturase-like protein (Delta9-desaturase) Bicyclus anynana (Squinting bush brown butterfly) 342 Q5S6Z6 Q5S6Z6_BICAN unreviewed Ruby (Fragment) Bicyclus anynana (Squinting bush brown butterfly) 139 V5QNY3 V5QNY3_9INSE unreviewed Histone H3 (Fragment) Rhithrogena sp. OPU_BS_R2012-102 109 A0A0D6DQD4 A0A0D6DQD4_BLAGE unreviewed Rhomboid-like protein (EC 3.4.21.-) (Fragment) Blattella germanica (German cockroach) (Blatta germanica) 375 A0A0D6DQG3 A0A0D6DQG3_BLAGE unreviewed Epidermal growth factor receptor (Fragment) egfr Blattella germanica (German cockroach) (Blatta germanica) 310 A0A0D6DQH9 A0A0D6DQH9_BLAGE unreviewed Blistered Blattella germanica (German cockroach) (Blatta germanica) 335 I2DBK9 I2DBK9_9INSE unreviewed Histone H3 (Fragment) Baetis sp. OPU_BS_B2011-147 109 H9BVN2 H9BVN2_NASVI unreviewed Unpaired-like protein (Fragment) Nasonia vitripennis (Parasitic wasp) 275 V5QNX6 V5QNX6_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Paraleptophlebia sp. OPU_BS_P2010-362 219 I2DBL9 I2DBL9_9INSE unreviewed Histone H3 (Fragment) Paraleptophlebia sp. OPU_BS_P2010-362 109 V5QR45 V5QR45_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Ameletus sp. OPU_BS_A2010-10 219 V5QPZ0 V5QPZ0_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Paraleptophlebia westoni 219 Q7YT29 Q7YT29_BOMMO unreviewed Transcription factor BmEts BmEts Bombyx mori (Silk moth) 389 A0A1V1GZK4 A0A1V1GZK4_PAPME unreviewed Doublesex (Fragment) Papilio memnon (Great mormon butterfly) 173 I2DBJ3 I2DBJ3_9INSE unreviewed Histone H3 (Fragment) Ameletus sp. OPU_BS_A2011-122 109 V5QP70 V5QP70_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena sp. OPU_BS_R2010-15 219 A0A1V1H564 A0A1V1H564_PAPME unreviewed Doublesex (Fragment) Papilio memnon (Great mormon butterfly) 173 V5QNQ7 V5QNQ7_9INSE unreviewed Histone H3 (Fragment) Rhithrogena sp. OPU_BS_R2012-157 109 B2ZA59 B2ZA59_MANSE unreviewed 4EBP-like protein Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) 115 A0A088B410 A0A088B410_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 119 A0A088B636 A0A088B636_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 116 A0A088B3R2 A0A088B3R2_COLVI unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Colinus virginianus (Northern bobwhite) (Tetrao virginianus) 121 A0A088B3Z2 A0A088B3Z2_CALCC unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla californica (California quail) (Lophortyx californica) 119 A0A088B4T2 A0A088B4T2_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 118 A0A088B454 A0A088B454_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 119 X2CLN9 X2CLN9_CALSU unreviewed Cytochrome b (Fragment) cytb Callipepla squamata (Scaled quail) 163 A0A088B5Q2 A0A088B5Q2_CALSU unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla squamata (Scaled quail) 103 A0A088B3W8 A0A088B3W8_OREPI unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Oreortyx pictus (Mountain quail) 120 A0A088B5Q8 A0A088B5Q8_CALSU unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla squamata (Scaled quail) 119 A0A088B3U1 A0A088B3U1_CALSU unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla squamata (Scaled quail) 121 A0A088B3X0 A0A088B3X0_OREPI unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Oreortyx pictus (Mountain quail) 121 A0A088B3W6 A0A088B3W6_OREPI unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Oreortyx pictus (Mountain quail) 121 A0A088B3Q9 A0A088B3Q9_CALSU unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla squamata (Scaled quail) 120 A0A088B4V9 A0A088B4V9_CALSU unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla squamata (Scaled quail) 110 A0A088B4G0 A0A088B4G0_CALSU unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla squamata (Scaled quail) 105 A0A088B3Z0 A0A088B3Z0_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 119 A0A088B5E1 A0A088B5E1_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 119 I2DBL5 I2DBL5_9INSE unreviewed Histone H3 (Fragment) Paraleptophlebia japonica 109 Q5I1L7 Q5I1L7_9INSE unreviewed Histone H3 (Fragment) Ameletus costalis 109 K9MMF3 K9MMF3_9INSE unreviewed Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment) COI Rhithrogena japonica 219 A0A088B662 A0A088B662_CALGM unreviewed NADH dehydrogenase subunit 2 (Fragment) ND2 Callipepla gambelii (Gambel's quail) (Lophortyx gambelii) 119
Combining queries¶
Combining terms in a `UniProt` query can be as straightforward as putting them in the same string, separated by a space.
For example:
query = "organism:rabbit tissue:eye"
will search for all entries deriving from rabbits that are found in the eye
In [6]:
# Combine queries for rabbit (organism) and eye (tissue), and search
query = "organism:rabbit tissue:eye"
result = service.search(query)
print(result)
Entry Entry name Status Protein names Gene names Organism Length Q866N2 MYOC_RABIT reviewed Myocilin (Trabecular meshwork-induced glucocorticoid response protein) [Cleaved into: Myocilin, N-terminal fragment (Myocilin 20 kDa N-terminal fragment); Myocilin, C-terminal fragment (Myocilin 35 kDa N-terminal fragment)] MYOC TIGR Oryctolagus cuniculus (Rabbit) 490 P14755 CRYL1_RABIT reviewed Lambda-crystallin (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) (Gul3DH) CRYL1 GUL3DH Oryctolagus cuniculus (Rabbit) 319 A4L9J0 MIP_RABIT reviewed Lens fiber major intrinsic protein (Aquaporin-0) MIP Oryctolagus cuniculus (Rabbit) 263 Q9TV70 DHDH_RABIT reviewed Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (EC 1.3.1.20) (D-xylose 1-dehydrogenase) (D-xylose-NADP dehydrogenase) (EC 1.1.1.179) (Dimeric dihydrodiol dehydrogenase) (Ory2DD) (Fragment) DHDH 2DD Oryctolagus cuniculus (Rabbit) 329 P41316 CRYAB_RABIT reviewed Alpha-crystallin B chain (Alpha(B)-crystallin) CRYAB Oryctolagus cuniculus (Rabbit) 175 P02493 CRYAA_RABIT reviewed Alpha-crystallin A chain CRYAA Oryctolagus cuniculus (Rabbit) 173 P55820 SNP25_RABIT reviewed Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein) (Fragments) SNAP25 SNAP Oryctolagus cuniculus (Rabbit) 54 A2IBH5 CRBB2_RABIT reviewed Beta-crystallin B2 (Beta-B2 crystallin) (Beta-crystallin Bp) CRYBB2 Oryctolagus cuniculus (Rabbit) 205 A4L9I8 CRBS_RABIT reviewed Beta-crystallin S (Gamma-S-crystallin) (Gamma-crystallin S) CRYGS Oryctolagus cuniculus (Rabbit) 179 A4L9I9 CRBA2_RABIT reviewed Beta-crystallin A2 (Beta-A2 crystallin) CRYBA2 Oryctolagus cuniculus (Rabbit) 197 Q0GA40 LGSN_RABIT reviewed Lengsin (Glutamate-ammonia ligase domain-containing protein 1) LGSN GLULD1 LGS Oryctolagus cuniculus (Rabbit) 571 A4L9J1 A4L9J1_RABIT unreviewed Lens fiber membrane intrinsic protein Lim2 LIM2 Oryctolagus cuniculus (Rabbit) 173 A4L9L8 A4L9L8_RABIT unreviewed Phakinin Bfsp2 Oryctolagus cuniculus (Rabbit) 396 Q9XSZ3 Q9XSZ3_RABIT unreviewed Eye sodium bicarbonate cotransport protein NBC2 (Fragment) Oryctolagus cuniculus (Rabbit) 88 Q95KK6 Q95KK6_RABIT unreviewed Beta A3-crystallin Oryctolagus cuniculus (Rabbit) 215 Q95KK5 Q95KK5_RABIT unreviewed Beta A1-crystallin Oryctolagus cuniculus (Rabbit) 198
Exercise 02 (10min)¶
Using key:value searches, can you find and download sets of entries for proteins that satisfy the following requirements? (HINT: this link to the UniProt query fields may be helpful, here):
- Found in sheep spleen
- Have "rxlr" in their name, have a publication with author name Pritchard, and are between 70aa and 80aa in length
- Derive from a quokka and have had their annotations manually reviewed
- Are found in cell membranes of horse heart tissue, and have had their annotations manually reviewed
In [7]:
# SOLUTION - EXERCISE 02
queries = ["organism:sheep tissue:spleen",
"author:pritchard name:rxlr length:[70 TO 80]",
"organism:quokka reviewed:yes",
"go:membrane organism:horse tissue:heart reviewed:yes"]
for query in queries:
print("\n%s" % query)
print("=" * len(query))
result = service.search(query)
print(result)
organism:sheep tissue:spleen ============================ Entry Entry name Status Protein names Gene names Organism Length P23907 PRIO_SHEEP reviewed Major prion protein (PrP) (CD antigen CD230) PRNP PRP SIP Ovis aries (Sheep) 256 Q95229 PDGFB_SHEEP reviewed Platelet-derived growth factor subunit B (PDGF subunit B) (PDGF-2) (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) PDGFB Ovis aries (Sheep) 241 Q5I2M4 TLR9_SHEEP reviewed Toll-like receptor 9 (CD antigen CD289) TLR9 Ovis aries (Sheep) 1029 O77727 K1C15_SHEEP reviewed Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15) KRT15 Ovis aries (Sheep) 453 A2P2I3 A2P2I3_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 142 A2P2G3 A2P2G3_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 142 A2P2I1 A2P2I1_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 145 A2P2H2 A2P2H2_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 144 A2P2I2 A2P2I2_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 145 A2P2H0 A2P2H0_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 139 A2P2H4 A2P2H4_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 138 A2P2H7 A2P2H7_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 139 A2P2I0 A2P2I0_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 142 A2P2H9 A2P2H9_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 140 A2P2H6 A2P2H6_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 144 A2P2G6 A2P2G6_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 139 A2P2H8 A2P2H8_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 140 A2P2H5 A2P2H5_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 140 A2P2G4 A2P2G4_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 141 A2P2H3 A2P2H3_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 140 A2P2I4 A2P2I4_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 143 A2P2G1 A2P2G1_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 141 A2P2G2 A2P2G2_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 140 A2P2H1 A2P2H1_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 138 A2P2G5 A2P2G5_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 141 A2P2G9 A2P2G9_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 137 A2P2G0 A2P2G0_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 132 A2P2G7 A2P2G7_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 140 A2P2G8 A2P2G8_SHEEP unreviewed VH region (Fragment) VH Ovis aries (Sheep) 139 author:pritchard name:rxlr length:[70 TO 80] ============================================ Entry Entry name Status Protein names Gene names Organism Length D0NKZ7 D0NKZ7_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22972 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 76 D0NPQ2 D0NPQ2_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_23016 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 77 D0NZW3 D0NZW3_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_23154 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 79 D0NC53 D0NC53_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_09497 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 71 D0RM37 D0RM37_PHYIT unreviewed Secreted RxLR effector peptide protein, putative (Fragment) PITG_23230 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 70 D0NCS4 D0NCS4_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22900 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 78 D0N8C9 D0N8C9_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22813 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 72 D0RM38 D0RM38_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_23231 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 72 D0NNG1 D0NNG1_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_23011 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 74 D0N0J8 D0N0J8_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22727 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 70 D0P4W7 D0P4W7_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_23216 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 77 D0NY99 D0NY99_PHYIT unreviewed PexRD36 secreted RxLR effector peptide, putative PITG_23132 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 76 D0NR19 D0NR19_PHYIT unreviewed Secreted RxLR effector peptide protein, putative (Fragment) PITG_23026 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 71 D0N526 D0N526_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22802 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 74 D0P471 D0P471_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_23206 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 80 D0NJW0 D0NJW0_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22987 PITG_23199 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 70 D0NC52 D0NC52_PHYIT unreviewed Secreted RxLR effector peptide protein, putative PITG_22889 PITG_22890 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 76 D0NX57 D0NX57_PHYIT unreviewed RXLR effector family protein, putative PITG_18160 Phytophthora infestans (strain T30-4) (Potato late blight fungus) 80 organism:quokka reviewed:yes ============================ Entry Entry name Status Protein names Gene names Organism Length P67840 HSP1_SETBR reviewed Sperm protamine P1 PRM1 Setonix brachyurus (Quokka) 61 go:membrane organism:horse tissue:heart reviewed:yes ==================================================== Entry Entry name Status Protein names Gene names Organism Length P00004 CYC_HORSE reviewed Cytochrome c CYCS CYC Equus caballus (Horse) 105 P27104 ANF_HORSE reviewed Natriuretic peptides A (Prepronatriodilatin) [Cleaved into: Atrial natriuretic factor (ANF) (Atrial natriuretic peptide) (ANP)] NPPA Equus caballus (Horse) 153 P68082 MYG_HORSE reviewed Myoglobin MB Equus caballus (Horse) 154
Combining terms with Boolean logic¶
Boolean logic allows you to combine search terms with each other in arbitrary ways using three operators, specifying whether:
- both terms are required (
AND) NOTE: this is implicitly what you have been doing in the examples above - either term is allowed (
OR) - a term is disallowed (
NOT)
Searches are read from left-to right, but the logic of a search can be controlled by placing the combinations you want to resolve first in parentheses (()). Combining these operators can build some extremely powerful searches. For example, to get all proteins from horses and sheep, identified in the ovary, and having length greater than 200aa, you could use the query:
query = "tissue:ovary AND (organism:sheep OR organism:horse) NOT length:[1 TO 200]"Processing query results¶
So far you have worked with the default output from bioservices, although you know from notebook 06 that UniProt can provide output in a number of useful formats for searches in the browser.
The default output is tabular, and gives a good idea of the nature and content of the entries you recover. In this section, you will see some ways to download search results in alternative formats, which can be useful for analysis.
All the output format options are controlled in a similar way, using the frmt=<format> argument when you conduct your search - with <format> being one of the allowed terms (see the bioservices documentation for a full list.
Tabular¶
The default datatype is the most flexible datatype for download: tabular.
This can be specified explicitly with the tab format:
result = service.search(query, frmt="tab")
In [8]:
# Make a query string, and run a remote search at UniProt,
# getting the result as tabular format
query = "Q01844"
result = service.search(query, frmt="tab")
# Inspect the result
print(result)
Entry Entry name Status Protein names Gene names Organism Length Q01844 EWS_HUMAN reviewed RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) EWSR1 EWS Homo sapiens (Human) 656 Q9NZ81 PRR13_HUMAN reviewed Proline-rich protein 13 (Taxane-resistance protein) PRR13 TXR1 BM-041 Homo sapiens (Human) 148 O95486 SC24A_HUMAN reviewed Protein transport protein Sec24A (SEC24-related protein A) SEC24A Homo sapiens (Human) 1093 O94855 SC24D_HUMAN reviewed Protein transport protein Sec24D (SEC24-related protein D) SEC24D KIAA0755 Homo sapiens (Human) 1032 Q9UBV8 PEF1_HUMAN reviewed Peflin (PEF protein with a long N-terminal hydrophobic domain) (Penta-EF hand domain-containing protein 1) PEF1 ABP32 UNQ1845/PRO3573 Homo sapiens (Human) 284 Q9NS23 RASF1_HUMAN reviewed Ras association domain-containing protein 1 RASSF1 RDA32 Homo sapiens (Human) 344 O15162 PLS1_HUMAN reviewed Phospholipid scramblase 1 (PL scramblase 1) (Ca(2+)-dependent phospholipid scramblase 1) (Erythrocyte phospholipid scramblase) (MmTRA1b) PLSCR1 Homo sapiens (Human) 318 Q99873 ANM1_HUMAN reviewed Protein arginine N-methyltransferase 1 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT1) (Interferon receptor 1-bound protein 4) PRMT1 HMT2 HRMT1L2 IR1B4 Homo sapiens (Human) 361 P35637 FUS_HUMAN reviewed RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) FUS TLS Homo sapiens (Human) 526 Q92993 KAT5_HUMAN reviewed Histone acetyltransferase KAT5 (EC 2.3.1.48) (60 kDa Tat-interactive protein) (Tip60) (Histone acetyltransferase HTATIP) (HIV-1 Tat interactive protein) (Lysine acetyltransferase 5) (cPLA(2)-interacting protein) KAT5 HTATIP TIP60 Homo sapiens (Human) 513 Q09472 EP300_HUMAN reviewed Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) EP300 P300 Homo sapiens (Human) 2414 Q9BWW4 SSBP3_HUMAN reviewed Single-stranded DNA-binding protein 3 (Sequence-specific single-stranded-DNA-binding protein) SSBP3 SSDP SSDP1 Homo sapiens (Human) 388 Q13077 TRAF1_HUMAN reviewed TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6) TRAF1 EBI6 Homo sapiens (Human) 416 Q12933 TRAF2_HUMAN reviewed TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3) TRAF2 TRAP3 Homo sapiens (Human) 501 Q92734 TFG_HUMAN reviewed Protein TFG (TRK-fused gene protein) TFG Homo sapiens (Human) 400 Q8N5M1 ATPF2_HUMAN reviewed ATP synthase mitochondrial F1 complex assembly factor 2 (ATP12 homolog) ATPAF2 ATP12 LP3663 Homo sapiens (Human) 289 P49910 ZN165_HUMAN reviewed Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7) ZNF165 ZPF165 ZSCAN7 Homo sapiens (Human) 485 Q8NDC0 MISSL_HUMAN reviewed MAPK-interacting and spindle-stabilizing protein-like (Mitogen-activated protein kinase 1-interacting protein 1-like) MAPK1IP1L C14orf32 Homo sapiens (Human) 245 B0QYK0 B0QYK0_HUMAN unreviewed RNA-binding protein EWS EWSR1 Homo sapiens (Human) 618 C9JGE3 C9JGE3_HUMAN unreviewed EWS RNA-binding protein variant 6 (RNA-binding protein EWS) EWSR1 Homo sapiens (Human) 620 A0A0D9SFL3 A0A0D9SFL3_HUMAN unreviewed RNA-binding protein EWS EWSR1 Homo sapiens (Human) 584 H7BY36 H7BY36_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 308 B0QYJ4 B0QYJ4_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 166 F8WC90 F8WC90_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 292 B0QYJ7 B0QYJ7_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 233 B0QYJ6 B0QYJ6_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 180 B0QYJ3 B0QYJ3_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 156 B0QYJ5 B0QYJ5_HUMAN unreviewed RNA-binding protein EWS (Fragment) EWSR1 Homo sapiens (Human) 77
By default, the columns that are returned are: Entry, Entry name, Status, Protein names, Gene names, Organism, and Length. But these can be modified by passing the columns=<list> argument, where the <list> is a comma-separated list of column names. For example:
columnlist = "id,entry name,length,organism,mass,domains,domain,pathway"
result = service.search(query, frmt="tab", columns=columnlist)
The list of allowed column names can be found by inspecting the content of the variable service._valid_columns.
In [9]:
# Make a query string
query = "Q01844"
# Define a list of columns we want to retrive
columnlist = "id,entry name,length,mass,go(cellular component)"
# Run the remote search
result = service.search(query, frmt="tab", columns=columnlist)
# View the result
print(result)
Entry Entry name Length Mass Gene ontology (cellular component) Q01844 EWS_HUMAN 656 68,478 cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleus [GO:0005634]; plasma membrane [GO:0005886] Q9NZ81 PRR13_HUMAN 148 15,385 cytosol [GO:0005829]; nucleoplasm [GO:0005654] O95486 SC24A_HUMAN 1093 119,749 COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; ER to Golgi transport vesicle membrane [GO:0012507]; Golgi membrane [GO:0000139] O94855 SC24D_HUMAN 1032 113,010 COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; ER to Golgi transport vesicle membrane [GO:0012507]; Golgi membrane [GO:0000139] Q9UBV8 PEF1_HUMAN 284 30,381 COPII vesicle coat [GO:0030127]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139] Q9NS23 RASF1_HUMAN 344 39,219 cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; microtubule organizing center [GO:0005815]; nucleus [GO:0005634]; spindle pole [GO:0000922] O15162 PLS1_HUMAN 318 35,049 cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; Golgi apparatus [GO:0005794]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; membrane raft [GO:0045121]; nucleolus [GO:0005730]; nucleus [GO:0005634]; plasma membrane [GO:0005886] Q99873 ANM1_HUMAN 361 41,516 cytoplasm [GO:0005737]; cytosol [GO:0005829]; methylosome [GO:0034709]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] P35637 FUS_HUMAN 526 53,426 dendritic spine head [GO:0044327]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; polysome [GO:0005844] Q92993 KAT5_HUMAN 513 58,582 NuA4 histone acetyltransferase complex [GO:0035267]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; Piccolo NuA4 histone acetyltransferase complex [GO:0032777]; Swr1 complex [GO:0000812]; transcription factor complex [GO:0005667] Q09472 EP300_HUMAN 2414 264,161 chromosome [GO:0005694]; cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription factor complex [GO:0005667] Q9BWW4 SSBP3_HUMAN 388 40,421 nucleus [GO:0005634]; protein complex [GO:0043234] Q13077 TRAF1_HUMAN 416 46,164 cytoplasm [GO:0005737]; cytosol [GO:0005829] Q12933 TRAF2_HUMAN 501 55,859 AIP1-IRE1 complex [GO:1990597]; CD40 receptor complex [GO:0035631]; cell cortex [GO:0005938]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; IRE1-TRAF2-ASK1 complex [GO:1990604]; membrane raft [GO:0045121]; nucleoplasm [GO:0005654]; TRAF2-GSTP1 complex [GO:0097057]; ubiquitin ligase complex [GO:0000151]; vesicle membrane [GO:0012506] Q92734 TFG_HUMAN 400 43,448 cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum exit site [GO:0070971]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139] Q8N5M1 ATPF2_HUMAN 289 32,772 cytosol [GO:0005829]; mitochondrion [GO:0005739]; nuclear speck [GO:0016607] P49910 ZN165_HUMAN 485 55,771 nucleus [GO:0005634] Q8NDC0 MISSL_HUMAN 245 24,269 B0QYK0 B0QYK0_HUMAN 618 64,929 nucleolus [GO:0005730]; nucleus [GO:0005634] C9JGE3 C9JGE3_HUMAN 620 65,135 A0A0D9SFL3 A0A0D9SFL3_HUMAN 584 61,415 H7BY36 H7BY36_HUMAN 308 32,182 B0QYJ4 B0QYJ4_HUMAN 166 17,327 F8WC90 F8WC90_HUMAN 292 30,904 B0QYJ7 B0QYJ7_HUMAN 233 24,563 B0QYJ6 B0QYJ6_HUMAN 180 19,160 B0QYJ3 B0QYJ3_HUMAN 156 16,278 B0QYJ5 B0QYJ5_HUMAN 77 8,170
Converting to a dataframe¶
The `pandas` module allows us to process tabular data into dataframes, just like in `R`.
To do this, we have to use the io.StringIO() class to make it think that our downloaded results are a file
df = pd.read_table(io.StringIO(result))
In [10]:
# Convert the last search result into a dataframe in Pandas
df = pd.read_table(io.StringIO(result))
# View the dataframe
df
Out[10]:
| Entry | Entry name | Length | Mass | Gene ontology (cellular component) | |
|---|---|---|---|---|---|
| 0 | Q01844 | EWS_HUMAN | 656 | 68,478 | cytoplasm [GO:0005737]; nucleolus [GO:0005730]... |
| 1 | Q9NZ81 | PRR13_HUMAN | 148 | 15,385 | cytosol [GO:0005829]; nucleoplasm [GO:0005654] |
| 2 | O95486 | SC24A_HUMAN | 1093 | 119,749 | COPII vesicle coat [GO:0030127]; cytosol [GO:0... |
| 3 | O94855 | SC24D_HUMAN | 1032 | 113,010 | COPII vesicle coat [GO:0030127]; cytosol [GO:0... |
| 4 | Q9UBV8 | PEF1_HUMAN | 284 | 30,381 | COPII vesicle coat [GO:0030127]; cytoplasm [GO... |
| 5 | Q9NS23 | RASF1_HUMAN | 344 | 39,219 | cytoplasm [GO:0005737]; microtubule [GO:000587... |
| 6 | O15162 | PLS1_HUMAN | 318 | 35,049 | cytosol [GO:0005829]; extracellular exosome [G... |
| 7 | Q99873 | ANM1_HUMAN | 361 | 41,516 | cytoplasm [GO:0005737]; cytosol [GO:0005829]; ... |
| 8 | P35637 | FUS_HUMAN | 526 | 53,426 | dendritic spine head [GO:0044327]; nucleoplasm... |
| 9 | Q92993 | KAT5_HUMAN | 513 | 58,582 | NuA4 histone acetyltransferase complex [GO:003... |
| 10 | Q09472 | EP300_HUMAN | 2414 | 264,161 | chromosome [GO:0005694]; cytosol [GO:0005829];... |
| 11 | Q9BWW4 | SSBP3_HUMAN | 388 | 40,421 | nucleus [GO:0005634]; protein complex [GO:0043... |
| 12 | Q13077 | TRAF1_HUMAN | 416 | 46,164 | cytoplasm [GO:0005737]; cytosol [GO:0005829] |
| 13 | Q12933 | TRAF2_HUMAN | 501 | 55,859 | AIP1-IRE1 complex [GO:1990597]; CD40 receptor ... |
| 14 | Q92734 | TFG_HUMAN | 400 | 43,448 | cytoplasm [GO:0005737]; cytosol [GO:0005829]; ... |
| 15 | Q8N5M1 | ATPF2_HUMAN | 289 | 32,772 | cytosol [GO:0005829]; mitochondrion [GO:000573... |
| 16 | P49910 | ZN165_HUMAN | 485 | 55,771 | nucleus [GO:0005634] |
| 17 | Q8NDC0 | MISSL_HUMAN | 245 | 24,269 | NaN |
| 18 | B0QYK0 | B0QYK0_HUMAN | 618 | 64,929 | nucleolus [GO:0005730]; nucleus [GO:0005634] |
| 19 | C9JGE3 | C9JGE3_HUMAN | 620 | 65,135 | NaN |
| 20 | A0A0D9SFL3 | A0A0D9SFL3_HUMAN | 584 | 61,415 | NaN |
| 21 | H7BY36 | H7BY36_HUMAN | 308 | 32,182 | NaN |
| 22 | B0QYJ4 | B0QYJ4_HUMAN | 166 | 17,327 | NaN |
| 23 | F8WC90 | F8WC90_HUMAN | 292 | 30,904 | NaN |
| 24 | B0QYJ7 | B0QYJ7_HUMAN | 233 | 24,563 | NaN |
| 25 | B0QYJ6 | B0QYJ6_HUMAN | 180 | 19,160 | NaN |
| 26 | B0QYJ3 | B0QYJ3_HUMAN | 156 | 16,278 | NaN |
| 27 | B0QYJ5 | B0QYJ5_HUMAN | 77 | 8,170 | NaN |
Doing this will produce a pandas dataframe that can be manipulated and analysed just like any other dataframe. We can, for instance, view a histogram of sequence lengths from the table above:
In [11]:
# Plot histogram from dataframe
df.hist();
Excel¶
You can download Excel spreadsheets directly from `UniProt`, just as with the browser interface.
result = service.search(query, frmt="xls")
You can't use the Excel output directly in your code without some file manipulation, and you'll have to save it to a file, as in the example below. Also, the downloaded format is not guaranteed to be current for your version of Excel, and the application may ask to repair it. But, if you want Excel output to share with/display to others, you can get it programmatically.
NOTE: the downloaded format is actually `.xlsx`, rather than `.xls` which is implied by the format
In [12]:
# Make a query string, and run a remote search at UniProt,
# getting the result as an Excel spreadsheer
query = "Q01844"
result = service.search(query, frmt="xls")
# Write the Excel spreadsheet to file
outfile = 'output/uniprot/Q01844.xlsx'
with open(outfile, 'wb') as ofh:
ofh.write(result)
FASTA sequence¶
If you're interested only in the FASTA format sequence for an entry, you can use the `fasta` option with `frmt` to recover the sequences directly, as in the example below:
In [13]:
# Make a query string, and run a remote search at UniProt,
# getting the result as FASTA sequence
query = "go:membrane organism:horse tissue:heart reviewed:yes"
result = service.search(query, frmt="fasta")
# Inspect the result
print(result)
>sp|P00004|CYC_HORSE Cytochrome c OS=Equus caballus GN=CYCS PE=1 SV=2 MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE >sp|P27104|ANF_HORSE Natriuretic peptides A OS=Equus caballus GN=NPPA PE=2 SV=1 MGSFSTIMASFLLFLAFQLQGQTRANPVYGSVSNGDLMDFKNLLDRLEDKMPLEDEVMPP QVLSDQSEEERAALSPLPEVPPWTGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLA APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR >sp|P68082|MYG_HORSE Myoglobin OS=Equus caballus GN=MB PE=1 SV=2 MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH PGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
pandas dataframe¶
In addition to the conversion of tabular output to a `pandas` dataframe above, you can ask the `UniProt()` instance to return a `pandas` dataframe directly, with the `.get_df()` method.
result = service.get_df(query)
For a single ID, it's possible to pass the ID directly, for example:
In [14]:
# Get a dataframe for a single accession ID
df = service.get_df('tissue:venom (organism:snake OR organism:mamba)')
# View the dataframe
df.head()
/Users/lpritc/anaconda3/envs/2018-03-06-ibioic/lib/python3.6/site-packages/IPython/core/interactiveshell.py:2850: DtypeWarning: Columns (2,3,4,17,18,21,23,24,28,29,30,33,34,38,39,40,41,42,43,44,45,46,47,49,50,51,52,53,54,56,57,58,59,60,61,62,63,64,65,66,67,68,69,71,72,73,78,79,80,81,82,85,88,89,90,91,95,97,99,104,105,106,107,108,109,110,111,112,113,114,115,116,144) have mixed types. Specify dtype option on import or set low_memory=False. if self.run_code(code, result):
Out[14]:
| Entry | Entry name | Gene names | Gene names (primary ) | Gene names (synonym ) | Gene names (ordered locus ) | Gene names (ORF ) | Organism | Organism ID | Protein names | ... | Taxonomic lineage IDs (GENUS) | Taxonomic lineage IDs (SUBGENUS) | Taxonomic lineage IDs (SPECIES GROUP) | Taxonomic lineage IDs (SPECIES SUBGROUP) | Taxonomic lineage IDs (SPECIES) | Taxonomic lineage IDs (SUBSPECIES) | Taxonomic lineage IDs (VARIETAS) | Taxonomic lineage IDs (FORMA) | Cross-reference (db_abbrev) | Cross-reference (EMBL) | |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 0 | P0DKR6 | 3SX1_DENPO | [] | NaN | NaN | NaN | NaN | Dendroaspis polylepis polylepis (Black mamba) | 8620 | Mambalgin-1 (Mamb-1) (Pi-Dp1) | ... | 8617 | NaN | NaN | NaN | 8624.0 | NaN | NaN | NaN | NaN | JX428743; |
| 1 | P0C1Z0 | 3SE2_DENAN | [] | NaN | NaN | NaN | NaN | Dendroaspis angusticeps (Eastern green mamba) ... | 8618 | Fasciculin-2 (Fas-2) (Fas2) (Acetylcholinester... | ... | 8617 | NaN | NaN | NaN | NaN | NaN | NaN | NaN | NaN | NaN |
| 2 | P00981 | VKTHK_DENPO | [] | NaN | NaN | NaN | NaN | Dendroaspis polylepis polylepis (Black mamba) | 8620 | Kunitz-type serine protease inhibitor homolog ... | ... | 8617 | NaN | NaN | NaN | 8624.0 | NaN | NaN | NaN | NaN | S61886; |
| 3 | Q8QGR0 | 3SIM7_DENAN | [] | NaN | NaN | NaN | NaN | Dendroaspis angusticeps (Eastern green mamba) ... | 8618 | Three-finger muscarinic toxin 7 (MT-7) (MT7) (... | ... | 8617 | NaN | NaN | NaN | NaN | NaN | NaN | NaN | NaN | AF241871; |
| 4 | Q58L94 | FAXD2_NOTSC | [] | NaN | NaN | NaN | NaN | Notechis scutatus scutatus (Mainland tiger sna... | 70142 | Venom prothrombin activator notecarin-D2 (vPA)... | ... | 8661 | NaN | NaN | NaN | 8663.0 | NaN | NaN | NaN | NaN | AY940206; |
5 rows × 178 columns
This dataframe works like any other dataframe. You can get a complete list of returned columns:
In [15]:
df.columns
Out[15]:
Index(['Entry', 'Entry name', 'Gene names', 'Gene names (primary )',
'Gene names (synonym )', 'Gene names (ordered locus )',
'Gene names (ORF )', 'Organism', 'Organism ID', 'Protein names',
...
'Taxonomic lineage IDs (GENUS)', 'Taxonomic lineage IDs (SUBGENUS)',
'Taxonomic lineage IDs (SPECIES GROUP)',
'Taxonomic lineage IDs (SPECIES SUBGROUP)',
'Taxonomic lineage IDs (SPECIES)', 'Taxonomic lineage IDs (SUBSPECIES)',
'Taxonomic lineage IDs (VARIETAS)', 'Taxonomic lineage IDs (FORMA)',
'Cross-reference (db_abbrev)', 'Cross-reference (EMBL)'],
dtype='object', length=178)
and use the convenient features of a dataframe, such as built-in plotting:
In [16]:
# Construct a histogram of returned sequence lengths
df.hist('Length', bins=100);
and grouping/subsetting:
In [17]:
# Subset out coral snakes
coral = df.loc[df["Organism"].str.contains("coral")]
# Plot a strip plot of sequence size by organism in the dataframe
output = sns.stripplot(y="Organism", x="Length",
data=coral) # Render strip plot
Exercise 03 (10min)¶
Can you use bioservices, UniProt and pandas to:
- download a dataframe for all proteins that have "rxlr" in their name
- render a violin plot (`sns.violinplot()`) that shows the distribution of protein lengths grouped according to the evidence for the protein
In [18]:
# SOLUTION - EXERCISE 03
# Get dataframe
df = service.get_df('name:rxlr')
# Draw violin plot
output = sns.violinplot(y="Protein existence", x="Length", data=df)
